LXL04_011580 | RubberDandelionOmics

Gene overview

LXL04_011580

Reference: OH-1004 Chr: Chr02 Coordinates: 167615463-167617123 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1371 bp · LXL04_011580|LXL04_011580|OH1004|cDNA

TGTAAACGGATAGTGAGTGTAGGGGGGGAAATGAAGCAAAATTCGTGGAGGTCAGCTTACAACAAGAATCAGTTGGGTTTCAAGATAGGGATTTCGATTTTGTTCCTGGGTTTTGGATTCATACTTATTTTCTCGCAATCATTCAGTGTGATACCTGATGTTTCTGATAATAATATTGATACCCCTGTAACAGAGAAGAACTTGAAGCTGATTCCTTCAGATTTTACAGACTCACCCAATAAAGAAATCAATCAGATTCA...

CDS

Download CDS FASTA

1341 bp · LXL04_011580|LXL04_011580|OH1004|CDS

ATGAAGCAAAATTCGTGGAGGTCAGCTTACAACAAGAATCAGTTGGGTTTCAAGATAGGGATTTCGATTTTGTTCCTGGGTTTTGGATTCATACTTATTTTCTCGCAATCATTCAGTGTGATACCTGATGTTTCTGATAATAATATTGATACCCCTGTAACAGAGAAGAACTTGAAGCTGATTCCTTCAGATTTTACAGACTCACCCAATAAAGAAATCAATCAGATTCATCCAAAAGTAACAAACTTTCTGGAACTGAA...

Protein

Download Protein FASTA

446 aa · LXL04_011580|LXL04_011580|OH1004|PROTEIN

MKQNSWRSAYNKNQLGFKIGISILFLGFGFILIFSQSFSVIPDVSDNNIDTPVTEKNLKLIPSDFTDSPNKEINQIHPKVTNFLELNVFPGNCCEDDKTGKCDIFSGDWIPSPDGSPYTNNSCRWIGSDQNCLTNGRPDTGYLYWRWKPKACDLPRFDPKKFLEMMRDKSWGFVGDSITRNHLQSFICILSQVEDAVDISDDKNCNKNQKWHFPSSNLTVSVIWSPFLAKTDTNGVQTSEIQLHIDILDKTWTELFDTWD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011580`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011580

Location Chr02:167615463-167617123 (-)

Description Similar to TBL23: Protein trichome birefringence-like 23

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11090`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At4g01080`	May be involved in the O-acetylation of mannan.	No verified direct reference in this release
`At4g23790`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release
`At1g01430`	May be involved in the O-acetylation of mannan.	No verified direct reference in this release
`At5g15900`	May act as a bridging protein that binds pectin and other cell wall polysaccharides.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011580 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0016413 O-acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G01430

ath:AT4G01080

ath:AT4G11090

ath:AT4G23790

ath:AT5G15900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.400

Rank 1 · LXL04_011580 · OH-1004

Endoplasmic reticulum0.112

Rank 2 · LXL04_011580 · OH-1004

Extracellular0.101

Rank 3 · LXL04_011580 · OH-1004

Cell membrane0.100

Rank 4 · LXL04_011580 · OH-1004

Lysosome / Vacuole0.074

Rank 5 · LXL04_011580 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14416.12PMR5N101-153 aa

PF13839.13PC-Esterase154-441 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011580	`PF14416.12`	PMR5N	101	153	3.1e-19	69.7
LXL04_011580	`PF13839.13`	PC-Esterase	154	441	1.4e-85	288.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82509`	Arabidopsis thaliana	Protein trichome birefringence-like 23	51.541%	Swiss-Prot	strong database homology
`O04621`	Arabidopsis thaliana	Protein trichome birefringence-like 26	53.352%	Swiss-Prot	strong database homology
`Q8H1R3`	Arabidopsis thaliana	Protein trichome birefringence-like 24	50.833%	Swiss-Prot	strong database homology
`Q84JH9`	Arabidopsis thaliana	Protein trichome birefringence-like 25	46.993%	Swiss-Prot	moderate database homology
`Q9LFT0`	Arabidopsis thaliana	Protein trichome birefringence-like 19	40.347%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card