LXL04_011455 | RubberDandelionOmics

Gene overview

LXL04_011455

Reference: OH-1004 Chr: Chr02 Coordinates: 164418465-164419395 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

702 bp · LXL04_011455|LXL04_011455|OH1004|cDNA

ATGACACGTGTCGATGGTATTTCTAATTCTAATGTTGCCGATGATGGTAAGGTACCAGAAACTAACCAACAATCAACACAACCGCCATCATCGGAACACGTTTTTGCTGCTCAACAGCCACAAGATCAAGGTATAACGTCTATGCATACGACACCACAAATTGTTATACAACCTCAATTTTTTATACAACCACCAGCAGTTGTATACGCCCCACCACCACAACTGCCACCACAGCCGCCGCCGCTGCCGCCTTTTCAACC...

CDS

Download CDS FASTA

702 bp · LXL04_011455|LXL04_011455|OH1004|CDS

ATGACACGTGTCGATGGTATTTCTAATTCTAATGTTGCCGATGATGGTAAGGTACCAGAAACTAACCAACAATCAACACAACCGCCATCATCGGAACACGTTTTTGCTGCTCAACAGCCACAAGATCAAGGTATAACGTCTATGCATACGACACCACAAATTGTTATACAACCTCAATTTTTTATACAACCACCAGCAGTTGTATACGCCCCACCACCACAACTGCCACCACAGCCGCCGCCGCTGCCGCCTTTTCAACC...

Protein

Download Protein FASTA

233 aa · LXL04_011455|LXL04_011455|OH1004|PROTEIN

MTRVDGISNSNVADDGKVPETNQQSTQPPSSEHVFAAQQPQDQGITSMHTTPQIVIQPQFFIQPPAVVYAPPPQLPPQPPPLPPFQPHINPPQPPQQPLPNQQGWTTGLPIQQGWTTGLFDCIDDPENAIITLCCPCVTFGQLASTIDNRGTSCEMSGMIYTVVALVIGMPCIISCTYRTKLRGRFGLMETPASDCITHLCCEYCALCQEYRELNNRGFNPSAGKSIAKIKPF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011455`
TK1151 ID	TkA03G589060
OH-1004 ID	LXL04_011455
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 79.828 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011455

Location Chr02:164418465-164419395 (-)

Description Similar to PCR6: Protein PLANT CADMIUM RESISTANCE 6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49030`	May be involved in heavy metals transport.	No verified direct reference in this release
`At3g18470`	May be involved in heavy metals transport.	No verified direct reference in this release
`At3g18460`	May be involved in heavy metals transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011455 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT1G49030

ath:AT3G18460

ath:AT3G18470

zma:100284761

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.468

Rank 1 · LXL04_011455 · OH-1004

Cytoplasm0.273

Rank 2 · LXL04_011455 · OH-1004

Endoplasmic reticulum0.142

Rank 3 · LXL04_011455 · OH-1004

Nucleus0.135

Rank 4 · LXL04_011455 · OH-1004

Lysosome / Vacuole0.133

Rank 5 · LXL04_011455 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04749.23PLAC8115-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011455	`PF04749.23`	PLAC8	115	213	9.3e-30	104.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9A5`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 6	59.091%	Swiss-Prot	weak database homology
`Q9LS43`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 7	53.448%	Swiss-Prot	weak database homology
`Q9LS44`	Arabidopsis thaliana	Protein PLANT CADMIUM RESISTANCE 4	45.752%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card