LXL04_011412 | RubberDandelionOmics

Gene overview

LXL04_011412

Reference: OH-1004 Chr: Chr02 Coordinates: 163937875-163940224 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2242 bp · LXL04_011412|LXL04_011412|OH1004|cDNA

TTTACTTTCAAAGACTAAAAAAGTCATAAAATATAAATAGCGAGAAAAAAAGTTCTTATCAGCCTACTCCCACACTACGCATCCACCAATCTGTGCAAATCGCATCCCGACTTCTGTCAAGAACACGACGGAGCAACAAACGAAGAAGCTTCAATCGGACCAAACATCACCAACAATCCTCTTCCTGTTGCTTCCGTTGTAATCAAAACAAATGAATTATATTCCTCCTCATCTTCTCCACTAATCCAATCCCCAAACCC...

CDS

Download CDS FASTA

1962 bp · LXL04_011412|LXL04_011412|OH1004|CDS

ATGATTTCACGAATCCCTCTATCGTTATTGTTCTTCTTCTTCACTCTTTTCATCTACCCATCGATCTCAAAATCACCTGCGCTTTCCCTTTCTTCAAATTCCCTCACTAAATCAAACAACTCGGTAACAATCAAATGGTCCGGAGTCGACTCACCTTCACAGCTCGACTGGCTCGGCATCTACACACCCCCCAACTCCTCGCTCCACGAATTCATCGGCTATCTCTACCTAAACACCTCATCCACGTGGGAATCCGGGTC...

Protein

Download Protein FASTA

653 aa · LXL04_011412|LXL04_011412|OH1004|PROTEIN

MISRIPLSLLFFFFTLFIYPSISKSPALSLSSNSLTKSNNSVTIKWSGVDSPSQLDWLGIYTPPNSSLHEFIGYLYLNTSSTWESGSGSITVPLINLRSKYKIRIFRWTDSEVIPTRHDHDGNPLPQPKHLLAETEEFQYEQVHAPDQIHLALTGEVGEMRVMFVTGHGKESVVKYGLDSGRMNQVVGTRVGRYEREDMCDSPANQTVGWRDPGFIHDGVMINLQPGRRYFYKVGSDSEGWSNTFSFVSPDNNSGETIAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011412`
TK1151 ID	TkA03G586440
OH-1004 ID	LXL04_011412
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 92.724 / OH-1004 76.110 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011412

Location Chr02:163937875-163940224 (-)

Description Similar to PAP2: Probable inactive purple acid phosphatase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13900`	Probable inactive purple acid phosphatase 2.	No verified direct reference in this release
`At2g03450`	Probable inactive purple acid phosphatase 9.	No verified direct reference in this release
`At1g13750`	Probable inactive purple acid phosphatase 1.	No verified direct reference in this release
`At5g50400`	Probable inactive purple acid phosphatase 27.	No verified direct reference in this release
`At4g24890`	Probable inactive purple acid phosphatase 24.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011412 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006109 regulation of carbohydrate metabolic process Biological Process

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0045037 protein import into chloroplast stroma Biological Process

GO:0045040 protein insertion into mitochondrial outer membrane Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005740 mitochondrial envelope Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G13750

ath:AT1G13900

ath:AT2G03450

ath:AT4G24890

ath:AT5G50400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.468

Rank 1 · LXL04_011412 · OH-1004

Golgi apparatus0.186

Rank 2 · LXL04_011412 · OH-1004

Cell membrane0.135

Rank 3 · LXL04_011412 · OH-1004

Endoplasmic reticulum0.120

Rank 4 · LXL04_011412 · OH-1004

Cytoplasm0.114

Rank 5 · LXL04_011412 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16656.12Pur_ac_phosph_N146-248 aa

PF00149.34Metallophos284-488 aa

PF14008.12Metallophos_C502-570 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011412	`PF16656.12`	Pur_ac_phosph_N	146	248	8.2e-19	68.7
LXL04_011412	`PF00149.34`	Metallophos	284	488	9.2e-14	53.0
LXL04_011412	`PF14008.12`	Metallophos_C	502	570	7.4e-16	59.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LMG7`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 2	62.154%	Swiss-Prot	strong database homology
`Q9ZQ81`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 9	61.503%	Swiss-Prot	strong database homology
`Q9LMX4`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 1	32.000%	Swiss-Prot	moderate database homology
`Q5MAU8`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 27	31.041%	Swiss-Prot	moderate database homology
`Q8H1R2`	Arabidopsis thaliana	Probable inactive purple acid phosphatase 24	29.947%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card