LXL04_011398 | RubberDandelionOmics

Gene overview

LXL04_011398

Reference: OH-1004 Chr: Chr02 Coordinates: 163786017-163789133 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · LXL04_011398|LXL04_011398|OH1004|cDNA

ATGTGTGGAATAGCGCTAATAATCTCCGGTGTGCGTATCGATTTATCGTCTCTTCTGCTAGATACAACCATTTATTCATCTCTTTCCGAAGAAACTGCAAATTTTTTATGTTCTGTAGATGATATCAAAGTATCTCTGAGGAGAAGGGGTCCTGACAGCTTAGGGAGCAAGTCCATATTCCTTCATACAGATGAGGAAAAAACTCTTCAATCTTCAGAAGAGAAAGACGAACCAATCACACAATCCCTCCTAATAAACAA...

CDS

Download CDS FASTA

1836 bp · LXL04_011398|LXL04_011398|OH1004|CDS

ATGTGTGGAATAGCGCTAATAATCTCCGGTGTGCGTATCGATTTATCGTCTCTTCTGCTAGATACAACCATTTATTCATCTCTTTCCGAAGAAACTGCAAATTTTTTATGTTCTGTAGATGATATCAAAGTATCTCTGAGGAGAAGGGGTCCTGACAGCTTAGGGAGCAAGTCCATATTCCTTCATACAGATGAGGAAAAAACTCTTCAATCTTCAGAAGAGAAAGACGAACCAATCACACAATCCCTCCTAATAAACAA...

Protein

Download Protein FASTA

611 aa · LXL04_011398|LXL04_011398|OH1004|PROTEIN

MCGIALIISGVRIDLSSLLLDTTIYSSLSEETANFLCSVDDIKVSLRRRGPDSLGSKSIFLHTDEEKTLQSSEEKDEPITQSLLINNSLSNNNSLGKALFIGATLQLRGQSPITQPLMDKSGNILVYNGEVFGGIELSSDSNDTEVLMNSLSECCNCLSHEHEGTCGNNKYSVPQLLSKIKGPWALIYWQEKSKTIWFGRDALGRRSLLVHWPSVKDSRFLLSSVSPPSAAIDELNFWEELPCGVYSMSMSASKMDENLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011398`
TK1151 ID	TkA02G610500
OH-1004 ID	LXL04_011398
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 59.574 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_011398`
Location	Chr02:163786017-163789133 (-)
Description	Similar to asnsd1: Asparagine synthetase domain-containing protein 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_011398` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0060290 transdifferentiation Biological Process GO:0070981 L-asparagine biosynthetic process Biological Process
KEGG gene cross-reference	bta:539672 dre:368827 gga:423983 mmu:70396 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · LXL04_011398 · OH-1004

Nucleus0.303

Rank 2 · LXL04_011398 · OH-1004

Peroxisome0.091

Rank 3 · LXL04_011398 · OH-1004

Mitochondrion0.088

Rank 4 · LXL04_011398 · OH-1004

Plastid0.073

Rank 5 · LXL04_011398 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13537.12GATase_7114-224 aa

PF13522.13GATase_6114-224 aa

PF00733.28Asn_synthase306-378 aa

PF00733.28Asn_synthase487-564 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011398	`PF13537.12`	GATase_7	114	224	4e-10	40.5
LXL04_011398	`PF13522.13`	GATase_6	114	224	1.1e-06	28.9
LXL04_011398	`PF00733.28`	Asn_synthase	306	378	4.3e-18	66.8
LXL04_011398	`PF00733.28`	Asn_synthase	487	564	4.3e-18	66.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card