LXL04_011262 | RubberDandelionOmics

Gene overview

LXL04_011262

Reference: OH-1004 Chr: Chr02 Coordinates: 161274227-161275845 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1064 bp · LXL04_011262|LXL04_011262|OH1004|cDNA

CTTCCTCCGCCATCAACGCCTTTAAATACCGAGTAAAAATTCTACGAAATGGGCGTGTTATTCGAGGCTAAGGAGGAGCAAGATAGGGCAGGATTGCTGGAAGATTTCTTAGAAAAAACTGGTGGATGCGCCGTCATCGACGGCGGCTTTGCCACACAACTAGAGATTCATGGCGCCTCCATTAACGACCCTCTATGGAGCGCACTCTGTTTGATCAATAGCCCTCATCTCATCTCTAAGGTCCACTTGGAATATCTGGA...

CDS

Download CDS FASTA

1005 bp · LXL04_011262|LXL04_011262|OH1004|CDS

ATGGGCGTGTTATTCGAGGCTAAGGAGGAGCAAGATAGGGCAGGATTGCTGGAAGATTTCTTAGAAAAAACTGGTGGATGCGCCGTCATCGACGGCGGCTTTGCCACACAACTAGAGATTCATGGCGCCTCCATTAACGACCCTCTATGGAGCGCACTCTGTTTGATCAATAGCCCTCATCTCATCTCTAAGGTCCACTTGGAATATCTGGAGGCCGGTGCTGATATTATCGTAACTTCTTCATATCAGGCTACGCTTCC...

Protein

Download Protein FASTA

334 aa · LXL04_011262|LXL04_011262|OH1004|PROTEIN

MGVLFEAKEEQDRAGLLEDFLEKTGGCAVIDGGFATQLEIHGASINDPLWSALCLINSPHLISKVHLEYLEAGADIIVTSSYQATLPGFISRGLSLEQGEKLLEKSVKLATDARDVFWKTVEKIDDHTYNRALVAASIGSYGAFLADGSEYNGNYGPDVDTNKLKDFHRRRLQVLVEAGPDLLAFETIPNKLEAQAVAELLEEENVEIPSWICFSSVDGINAPSGESFADCLEVLNKSKKIAAVGINCTPPQFVNNLIQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011262`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011262

Location Chr02:161274227-161275845 (+)

Description Similar to HMT1: Homocysteine S-methyltransferase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g25900`	Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet).	No verified direct reference in this release
`At3g22740`	Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet).	No verified direct reference in this release
`At3g63250`	Catalyzes methyl transfer from S-methylmethionine (SMM) to adenosyl-L-homocysteine (AdoMet).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011262 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009086 methionine biosynthetic process Biological Process

GO:0032259 methylation Biological Process

GO:0033528 S-methylmethionine cycle Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0008898 S-adenosylmethionine-homocysteine S-methyltransferase activity Molecular Function

GO:0061627 S-methylmethionine-homocysteine S-methyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G22740

ath:AT3G25900

ath:AT3G63250

zma:541873

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.675

Rank 1 · LXL04_011262 · OH-1004

Nucleus0.311

Rank 2 · LXL04_011262 · OH-1004

Mitochondrion0.100

Rank 3 · LXL04_011262 · OH-1004

Cell membrane0.071

Rank 4 · LXL04_011262 · OH-1004

Peroxisome0.057

Rank 5 · LXL04_011262 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02574.23S-methyl_trans29-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011262	`PF02574.23`	S-methyl_trans	29	329	4.1e-76	257.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SDL7`	Arabidopsis thaliana	Homocysteine S-methyltransferase 1	72.671%	Swiss-Prot	strong database homology
`Q8LAX0`	Arabidopsis thaliana	Homocysteine S-methyltransferase 3	54.878%	Swiss-Prot	strong database homology
`Q9M1W4`	Arabidopsis thaliana	Homocysteine S-methyltransferase 2	56.426%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card