LXL04_011175 | RubberDandelionOmics

Gene overview

LXL04_011175

Reference: OH-1004 Chr: Chr02 Coordinates: 159358905-159359282 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

378 bp · LXL04_011175|LXL04_011175|OH1004|cDNA

ATGTCGTCTTACATTCTATCATTTTTCAACCGTTTGTTAGTGGCAATTGATTTCTTGATCAACTATGTCTTACTCCACCATCGTAGCATGCTCCACCTGCCGGAAAATGAAGAGGCGGAGTGTGCCATTTGCTTGAGCAAGATTGAAGATGACGATGAGATTTGGGAATTAAGGTGTGATCATCTCTTTCACAAAAACTGCTTGGATACGTGGATCTCATGTAAACATACAACTTCAACGTGCCCTTTATGCCGTGATAA...

CDS

Download CDS FASTA

378 bp · LXL04_011175|LXL04_011175|OH1004|CDS

ATGTCGTCTTACATTCTATCATTTTTCAACCGTTTGTTAGTGGCAATTGATTTCTTGATCAACTATGTCTTACTCCACCATCGTAGCATGCTCCACCTGCCGGAAAATGAAGAGGCGGAGTGTGCCATTTGCTTGAGCAAGATTGAAGATGACGATGAGATTTGGGAATTAAGGTGTGATCATCTCTTTCACAAAAACTGCTTGGATACGTGGATCTCATGTAAACATACAACTTCAACGTGCCCTTTATGCCGTGATAA...

Protein

Download Protein FASTA

125 aa · LXL04_011175|LXL04_011175|OH1004|PROTEIN

MSSYILSFFNRLLVAIDFLINYVLLHHRSMLHLPENEEAECAICLSKIEDDDEIWELRCDHLFHKNCLDTWISCKHTTSTCPLCRDNLVVPPKIDGVCEMGNQDVLFYDFCGTDSSEDEGRWWVR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011175`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011175

Location Chr02:159358905-159359282 (+)

Description Similar to XERICO: Probable E3 ubiquitin-protein ligase XERICO

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g04240`	Function on abscisic acid homeostasis at post-translational level, probably through ubiquitin/proteasome-dependent substrate- specific degradation.	Upregulation of an Arabidopsis RING-H2 gene, XERICO, confers drought tolerance through increased abscisic acid biosynthesis.2006 · DOI: 10.1111/j.1365-313x.2006.02782.x Global analysis of della direct targets in early gibberellin signaling in Arabidopsis.2007 · DOI: 10.1105/tpc.107.054999
`At3g05200`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	No verified direct reference in this release
`At4g09120`	Putative RING-H2 finger protein ATL36.	No verified direct reference in this release
`At1g22500`	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8, UBC10, UBC11, UBC28 and UBC29 in vitro.	No verified direct reference in this release
`At5g57750`	Putative RING-H2 finger protein ATL50.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011175 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006970 response to osmotic stress Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009687 abscisic acid metabolic process Biological Process

GO:0009688 abscisic acid biosynthetic process Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0033591 response to L-ascorbic acid Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0098542 defense response to other organism Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G22500

ath:AT2G04240

ath:AT3G05200

ath:AT4G09120

ath:AT5G57750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.378

Rank 1 · LXL04_011175 · OH-1004

Nucleus0.352

Rank 2 · LXL04_011175 · OH-1004

Endoplasmic reticulum0.169

Rank 3 · LXL04_011175 · OH-1004

Cell membrane0.128

Rank 4 · LXL04_011175 · OH-1004

Lysosome / Vacuole0.109

Rank 5 · LXL04_011175 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13639.13zf-RING_240-85 aa

PF17123.12zf-RING_1140-68 aa

PF14634.13zf-RING_540-85 aa

PF00097.32zf-C3HC441-84 aa

PF12861.14zf-ANAPC1151-89 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011175	`PF13639.13`	zf-RING_2	40	85	2.9e-12	47.4
LXL04_011175	`PF17123.12`	zf-RING_11	40	68	8.3e-10	38.9
LXL04_011175	`PF14634.13`	zf-RING_5	40	85	1.8e-06	28.6
LXL04_011175	`PF00097.32`	zf-C3HC4	41	84	3.8e-08	33.8
LXL04_011175	`PF12861.14`	zf-ANAPC11	51	89	2.2e-06	28.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SI09`	Arabidopsis thaliana	Probable E3 ubiquitin-protein ligase XERICO	46.377%	Swiss-Prot	moderate database homology
`Q8RXX9`	Arabidopsis thaliana	E3 ubiquitin-protein ligase ATL6	50.000%	Swiss-Prot	weak database homology
`Q9M0R5`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL36	51.852%	Swiss-Prot	weak database homology
`Q9SK92`	Arabidopsis thaliana	E3 ubiquitin-protein ligase ATL15	43.860%	Swiss-Prot	weak database homology
`Q9FHG8`	Arabidopsis thaliana	Putative RING-H2 finger protein ATL50	43.662%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card