Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3081 bp · LXL04_011113|LXL04_011113|OH1004|cDNA
ATGGATCTTCCAAGTCTTGCTGTTGTTCTGCAAGCAGCACTCAGTCCCAATCCTGCTGAAAGAAAAGCCGGTGAAGAGAGTCTCAATAAGTATCAGTATACTCCTCAGCATCTGGTAAGGCTGCTGCAGATAATCGTAGATGGAAATTGTGATTTGGCAGTGCGGCAGGTTGCAAGTATtcatttcaagaacttcatagcAGAAAACTGGTCACCTCATGATCCAGATGAACAATCAAAGATTTCACCAAGTGATAAGGA...
3081 bp · LXL04_011113|LXL04_011113|OH1004|CDS
ATGGATCTTCCAAGTCTTGCTGTTGTTCTGCAAGCAGCACTCAGTCCCAATCCTGCTGAAAGAAAAGCCGGTGAAGAGAGTCTCAATAAGTATCAGTATACTCCTCAGCATCTGGTAAGGCTGCTGCAGATAATCGTAGATGGAAATTGTGATTTGGCAGTGCGGCAGGTTGCAAGTATTCATTTCAAGAACTTCATAGCAGAAAACTGGTCACCTCATGATCCAGATGAACAATCAAAGATTTCACCAAGTGATAAGGA...
Protein
Download Protein FASTA1026 aa · LXL04_011113|LXL04_011113|OH1004|PROTEIN
MDLPSLAVVLQAALSPNPAERKAGEESLNKYQYTPQHLVRLLQIIVDGNCDLAVRQVASIHFKNFIAENWSPHDPDEQSKISPSDKELVRQNILLFVEQVPTLLRAQLGECLKTIIHADYPEQWPGLLHWVTLNLQGQQVYGALFVLRILSRKYEFKSDEERTPVHHVVEETFPHLLNIFSRLVQIGNPSIEVADLIKLICKIYWSSIYLEIPKKLFDPNVFNAWMILFLNILERPVPLEGQPTDPDLRKSWGWWKVKKW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_011113 |
|---|---|
| TK1151 ID | TkA03G565860 |
| OH-1004 ID | LXL04_011113 |
| Relationship / confidence | Multi Candidate From Tk1151 / Complex relationship |
| Protein identity (%) | 98.500 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 78.070Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_011113 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:158058195-158063552 (+) | |||||||||
| Description | Similar to SAD2: Importin beta-like SAD2 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006606 protein import into nucleus Biological Process GO:0045087 innate immune response Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:1900182 positive regulation of protein localization to nucleus Biological Process GO:0005634 nucleus Cellular Component GO:0005635 nuclear envelope Cellular Component GO:0005643 nuclear pore Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0030695 GTPase regulator activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT2G31660 ath:AT3G59020 ddi:DDB_G0269860 hsa:10527 mmu:233726 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03810.26IBN_N25-95 aaPF08506.17Cse1153-444 aaPF25018.2HEAT_IPO9_c358-533 aaPF25758.2TPR_IPO11635-904 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_011113 | PF03810.26 | IBN_N | 25 | 95 | 5.3e-17 | 62.3 |
| LXL04_011113 | PF08506.17 | Cse1 | 153 | 444 | 1.3e-10 | 41.5 |
| LXL04_011113 | PF25018.2 | HEAT_IPO9_c | 358 | 533 | 9.2e-06 | 25.9 |
| LXL04_011113 | PF25758.2 | TPR_IPO11 | 635 | 904 | 1.5e-08 | 34.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.