LXL04_010964 | RubberDandelionOmics

Gene overview

LXL04_010964

Reference: OH-1004 Chr: Chr02 Coordinates: 155792100-155793425 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1075 bp · LXL04_010964|LXL04_010964|OH1004|cDNA

TTAGAAAGATCGTCGTTCTGTGGAGACTTGAAAGAGAAGATCAACACCTGCAGATATGAGTCTGGTAGCAGGATCATACGAGCGATTCATTTGGGGTTTCAAGCTCAAAACCCTAAAACACTCCACCGAAACCCTAGCCCTGTCCCCAATTTTCTCTTTCCCATCGCATCAGTCACCTATTAAGTCCGTCGCCGTCGCCGGCTCAGTCGCTGTTTCAGGTGGTTCCGATGACACAATCAAAATATACGACCTCTCAACTT...

CDS

Download CDS FASTA

1020 bp · LXL04_010964|LXL04_010964|OH1004|CDS

ATGAGTCTGGTAGCAGGATCATACGAGCGATTCATTTGGGGTTTCAAGCTCAAAACCCTAAAACACTCCACCGAAACCCTAGCCCTGTCCCCAATTTTCTCTTTCCCATCGCATCAGTCACCTATTAAGTCCGTCGCCGTCGCCGGCTCAGTCGCTGTTTCAGGTGGTTCCGATGACACAATCAAAATATACGACCTCTCAACTTCATCGGAGGTTGGTTCACTCAACGATCCAACCGCCACCGTGACAGCGCTCGCCCT...

Protein

Download Protein FASTA

339 aa · LXL04_010964|LXL04_010964|OH1004|PROTEIN

MSLVAGSYERFIWGFKLKTLKHSTETLALSPIFSFPSHQSPIKSVAVAGSVAVSGGSDDTIKIYDLSTSSEVGSLNDPTATVTALALFTPPSLSSFPRNLFSAYDDGNISFYDADPFVHLKTLKIHKKGVNDMSVHPSGKLALTVGRDSCLGMVNLVRGRRSFFCSLGKEASMVKFDCSGDKFFMVMDEKVSVHEAEDAKLILELESKKKVLCIAPGMNGLVYAGGEDRNLTAWDTVTGKVAYCIEDAHSARLKGIVVLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010964`
TK1151 ID	TkAUNG091120
OH-1004 ID	LXL04_010964
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_010964`
Location	Chr02:155792100-155793425 (-)
Description	Similar to pak1ip1: p21-activated protein kinase-interacting protein 1-like
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010964` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0008283 cell population proliferation Biological Process GO:0009968 negative regulation of signal transduction Biological Process GO:0042273 ribosomal large subunit biogenesis Biological Process GO:0005730 nucleolus Cellular Component GO:0004860 protein kinase inhibitor activity Molecular Function
KEGG gene cross-reference	dre:336470 gga:420850 hsa:55003 mmu:68083 xla:447245 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.905

Rank 1 · LXL04_010964 · OH-1004

Cytoplasm0.169

Rank 2 · LXL04_010964 · OH-1004

Cell membrane0.023

Rank 3 · LXL04_010964 · OH-1004

Mitochondrion0.015

Rank 4 · LXL04_010964 · OH-1004

Endoplasmic reticulum0.014

Rank 5 · LXL04_010964 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25172.2Beta-prop_WDR3_2nd32-151 aa

PF25171.2Beta-prop_WDR36-Utp21_1st32-152 aa

PF25173.2Beta-prop_WDR3_1st33-151 aa

PF24807.2WD40_CDC20-Fz33-243 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd37-185 aa

PF25174.2Beta-prop_THOC339-247 aa

PF24817.2WD40_WDHD1_1st39-125 aa

PF24814.2WD40_Prp1941-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010964	`PF25172.2`	Beta-prop_WDR3_2nd	32	151	5.6e-15	56.1
LXL04_010964	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	32	152	5e-11	43.2
LXL04_010964	`PF25173.2`	Beta-prop_WDR3_1st	33	151	4e-19	69.8
LXL04_010964	`PF24807.2`	WD40_CDC20-Fz	33	243	3e-13	50.4
LXL04_010964	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	37	185	2.2e-07	31.2
LXL04_010964	`PF25174.2`	Beta-prop_THOC3	39	247	9.3e-19	68.2
LXL04_010964	`PF24817.2`	WD40_WDHD1_1st	39	125	1.3e-13	51.6
LXL04_010964	`PF24814.2`	WD40_Prp19	41	160	3.7e-22	79.4
LXL04_010964	`PF24817.2`	WD40_WDHD1_1st	126	295	1.3e-13	51.6
LXL04_010964	`PF23414.2`	Beta-prop_EML_2	134	322	1.5e-09	38.4
LXL04_010964	`PF25173.2`	Beta-prop_WDR3_1st	186	289	4e-19	69.8
LXL04_010964	`PF25175.2`	Beta-prop_WDR5	188	290	6.9e-19	68.9
LXL04_010964	`PF23409.2`	Beta-prop_EML	202	309	3.1e-09	37.4
LXL04_010964	`PF25047.1`	Beta-prop_TEP1_2nd	203	290	1.5e-09	38.1
LXL04_010964	`PF24814.2`	WD40_Prp19	212	289	3.7e-22	79.4
LXL04_010964	`PF24796.2`	WDR55	222	290	3.4e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card