LXL04_010847 | RubberDandelionOmics

Gene overview

LXL04_010847

Reference: OH-1004 Chr: Chr02 Coordinates: 154390426-154394202 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1766 bp · LXL04_010847|LXL04_010847|OH1004|cDNA

AAATATTCGAAAAGCGGCCAACGTGGCCGTTTCCTTTCCCAACAAAATATACTCTTCTCGCAAAATCCAGAACACAATAAAGTGATAAACAACACATTCCCCTACCTCTCTCACTATCTCATCCACTGACACCGATGGGCACCATGGAGGCGGAGATCCCCGGAGGACCGGTACCGGTTGCCGTGAACCCCAAACCGAAGACAGGCTTTTCTTCCAAAGCAGTTGATTGGTTGGAGAAGCTTGTAGTTAAGCTAATGTAT...

CDS

Download CDS FASTA

1641 bp · LXL04_010847|LXL04_010847|OH1004|CDS

CTGACACCGATGGGCACCATGGAGGCGGAGATCCCCGGAGGACCGGTACCGGTTGCCGTGAACCCCAAACCGAAGACAGGCTTTTCTTCCAAAGCAGTTGATTGGTTGGAGAAGCTTGTAGTTAAGCTAATGTATGATTCCTCTCAGCCTCATCACTGGCTGTTCGGTAATTTTGCTCCTGTTGATGAAACTCCTCCTTGTAAAGACCTTCCTGTTATCGGTCACCTACCGGAGTGCCTGAATGGAGAGTTTGTTAGAGT...

Protein

Download Protein FASTA

546 aa · LXL04_010847|LXL04_010847|OH1004|PROTEIN

MTPMGTMEAEIPGGPVPVAVNPKPKTGFSSKAVDWLEKLVVKLMYDSSQPHHWLFGNFAPVDETPPCKDLPVIGHLPECLNGEFVRVGPNPKFAPVAGYHWFDGDGMIHGLRIKDGKATYLSRYVKTSRLAQEEFFGGAKFMKIGDLKGLFGLLMVNMQMLRTKLKVLDLSFGQGTGNTALIYHHKKLLALSEGDKPYAIKVLEDGDLQTLGLMDYDKRLSHTFTAHPKIDPITGEMFTFGYAQAPPFVTYRVISKDGVM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010847`
TK1151 ID	TkA03G551610
OH-1004 ID	LXL04_010847
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 93.333 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010847

Location Chr02:154390426-154394202 (-)

Description Similar to CCD1: Carotenoid 9,10(9',10')-cleavage dioxygenase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g63520`	Cleaves a variety of carotenoids symmetrically at both the 9- 10 and 9'-10' double bonds.	Characterization of three members of the Arabidopsis carotenoid cleavage dioxygenase family demonstrates the divergent roles of this multifunctional enzyme family.2006 · DOI: 10.1111/j.1365-313x.2006.02666.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010847 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0016118 carotenoid catabolic process Biological Process

GO:0016121 carotene catabolic process Biological Process

GO:0016124 xanthophyll catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0010436 carotenoid dioxygenase activity Molecular Function

GO:0045549 9-cis-epoxycarotenoid dioxygenase activity Molecular Function

KEGG gene cross-reference

ath:AT3G63520

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.324

Rank 1 · LXL04_010847 · OH-1004

Plastid0.190

Rank 2 · LXL04_010847 · OH-1004

Cell membrane0.186

Rank 3 · LXL04_010847 · OH-1004

Mitochondrion0.161

Rank 4 · LXL04_010847 · OH-1004

Nucleus0.089

Rank 5 · LXL04_010847 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03055.22RPE6558-535 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010847	`PF03055.22`	RPE65	58	535	1e-138	464.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O65572`	Arabidopsis thaliana	Carotenoid 9,10(9',10')-cleavage dioxygenase 1	77.737%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card