Gene Card
Gene overview
cDNA / CDS / Protein Sequences
3468 bp · LXL04_010556|LXL04_010556|OH1004|cDNA
ATGAACCACTTGGAGCTACTGCCTATTGCAATTGACGAAAAGCTGTGTGTTTGCGTTAGACATTTCGTCGAATGGGTTAACGACAGTCGTTCTACAGCTTCACACAAACATAGCAAGGCATTACATAGTTTCTCAAGCTGTTCTTCAATTGGAAGTGGTCAAACATGTGAGAGACTTCTAGAAGTTGGTTTAAAAAGGGTGACAGTATCTTGCATTCTTAATAGTAGACATGCTAAAGCTCCAAACTTGAAACCTCAGAA...
3468 bp · LXL04_010556|LXL04_010556|OH1004|CDS
ATGAACCACTTGGAGCTACTGCCTATTGCAATTGACGAAAAGCTGTGTGTTTGCGTTAGACATTTCGTCGAATGGGTTAACGACAGTCGTTCTACAGCTTCACACAAACATAGCAAGGCATTACATAGTTTCTCAAGCTGTTCTTCAATTGGAAGTGGTCAAACATGTGAGAGACTTCTAGAAGTTGGTTTAAAAAGGGTGACAGTATCTTGCATTCTTAATAGTAGACATGCTAAAGCTCCAAACTTGAAACCTCAGAA...
Protein
Download Protein FASTA1155 aa · LXL04_010556|LXL04_010556|OH1004|PROTEIN
MNHLELLPIAIDEKLCVCVRHFVEWVNDSRSTASHKHSKALHSFSSCSSIGSGQTCERLLEVGLKRVTVSCILNSRHAKAPNLKPQKPYFSIRSHTNRSYSTFPFQPPSRSGGPLIRPMSAINYGIVNGGFGIFTPFRPFSQSPRAVLPKNDACDGEGKSKSTSFLAFNKHWKQSKRLNHKKPLEVGGRTYPKSINAVKKDDILSLKDSTVEDVKIEVNLVDNESQPPKTKPKRKSTPKVKKSQEKSVVASEEPSVQASP...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010556 |
|---|---|
| TK1151 ID | TkAUNG098130 |
| OH-1004 ID | LXL04_010556 |
| Relationship / confidence | Sequence Supported Annotation Or Model Conflict / Review |
| Protein identity (%) | 97.800 |
| Protein coverage (%) | TK1151 98.986 / OH-1004 59.134Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010556 |
|---|---|
| Location | Chr02:149005388-149010038 (-) |
| Description | Similar to topA: DNA topoisomerase 1 (Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006265 DNA topological change Biological Process GO:0005694 chromosome Cellular Component GO:0003677 DNA binding Molecular Function GO:0003917 DNA topoisomerase type I (single strand cut, ATP-independent) activity Molecular Function GO:0008270 zinc ion binding Molecular Function |
| KEGG gene cross-reference | rbe:RBE_0712 rco:RC0449 rfe:RF_0530 rpr:RP326 rty:RT0317 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01751.29Toprim352-465 aaPF01131.26Topoisom_bac480-919 aaPF01396.25Zn_ribbon_Top1963-999 aaPF13368.12Toprim_C_rpt1026-1082 aaPF13368.12Toprim_C_rpt1087-1140 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010556 | PF01751.29 | Toprim | 352 | 465 | 4.6e-17 | 62.7 |
| LXL04_010556 | PF01131.26 | Topoisom_bac | 480 | 919 | 6.8e-111 | 371.9 |
| LXL04_010556 | PF01396.25 | Zn_ribbon_Top1 | 963 | 999 | 1.5e-08 | 35.0 |
| LXL04_010556 | PF13368.12 | Toprim_C_rpt | 1026 | 1082 | 7.4e-21 | 74.5 |
| LXL04_010556 | PF13368.12 | Toprim_C_rpt | 1087 | 1140 | 7.4e-21 | 74.5 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.