Gene Card
Gene overview
cDNA / CDS / Protein Sequences
399 bp · LXL04_010437|LXL04_010437|OH1004|cDNA
ATGGGGGAGCATGTGGAAGCAGACAACGCAGAAGCTATCATCACAAGGATCGAGCACAAGTCTCGCAAGATCGAGAGTTTACTCAAACAGTACAAGCCAGTAGAAGCCCTCAAAACTGCTCTGGAAGGATCTCCCCCCAAGACGAGAGATGAAAGGTGCAAGTCTGCAAATTGGATCGTGGTGCATAGAGCGTTAATGGCGATAAAAGATGTGGATTTAATGTTCACCTCTTTAGATCCCGAGTACTATGATATTCTGAT...
399 bp · LXL04_010437|LXL04_010437|OH1004|CDS
ATGGGGGAGCATGTGGAAGCAGACAACGCAGAAGCTATCATCACAAGGATCGAGCACAAGTCTCGCAAGATCGAGAGTTTACTCAAACAGTACAAGCCAGTAGAAGCCCTCAAAACTGCTCTGGAAGGATCTCCCCCCAAGACGAGAGATGAAAGGTGCAAGTCTGCAAATTGGATCGTGGTGCATAGAGCGTTAATGGCGATAAAAGATGTGGATTTAATGTTCACCTCTTTAGATCCCGAGTACTATGATATTCTGAT...
Protein
Download Protein FASTA132 aa · LXL04_010437|LXL04_010437|OH1004|PROTEIN
MGEHVEADNAEAIITRIEHKSRKIESLLKQYKPVEALKTALEGSPPKTRDERCKSANWIVVHRALMAIKDVDLMFTSLDPEYYDILMKYLYRGLSTGDRPTCDQCLRIHEKLTQRAGLGCILRALSDTVNTV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_010437 |
|---|---|
| TK1151 ID | TkAUNG055140 |
| OH-1004 ID | LXL04_010437 |
| Relationship / confidence | Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_010437 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:146558148-146558927 (+) | |||||||||
| Description | Similar to ARPC5A: Actin-related protein 2/3 complex subunit 5A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006887 exocytosis Biological Process GO:0006909 phagocytosis Biological Process GO:0007015 actin filament organization Biological Process GO:0009825 multidimensional cell growth Biological Process GO:0010090 trichome morphogenesis Biological Process GO:0014909 smooth muscle cell migration Biological Process GO:0016477 cell migration Biological Process GO:0030011 maintenance of cell polarity Biological Process GO:0030036 actin cytoskeleton organization Biological Process GO:0030041 actin filament polymerization Biological Process GO:0030833 regulation of actin filament polymerization Biological Process GO:0034314 Arp2/3 complex-mediated actin nucleation Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT4G01710 ath:AT5G65274 ddi:DDB_G0288319 rno:360854 xla:446537 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF04699.20P16-Arc9-128 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_010437 | PF04699.20 | P16-Arc | 9 | 128 | 1.8e-22 | 81.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.