LXL04_010343 | RubberDandelionOmics

Gene overview

LXL04_010343

Reference: OH-1004 Chr: Chr02 Coordinates: 144514602-144515108 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

507 bp · LXL04_010343|LXL04_010343|OH1004|cDNA

ATGGCGGATGTTTACAAAGGTGATCTTGATTCCACTGGAATCAAGTTATTCGGCAAGATGATTAACGTACAAGCCATGAGAGAATTGAAAGAAGAGCATGCAAGCAAATCAGAAATTGATGACGATGATGATCAAACCCTAGTGAATAAGAGGCCAGACAAGATCATACCGTGCCCTAGGTGCAAAAGCATGGAGACTAAGTTTTGCTATTTCAACAATTACAATGTTAATCAGCCAAGACACTTTTGTAAAGGGTGTCA...

CDS

Download CDS FASTA

507 bp · LXL04_010343|LXL04_010343|OH1004|CDS

ATGGCGGATGTTTACAAAGGTGATCTTGATTCCACTGGAATCAAGTTATTCGGCAAGATGATTAACGTACAAGCCATGAGAGAATTGAAAGAAGAGCATGCAAGCAAATCAGAAATTGATGACGATGATGATCAAACCCTAGTGAATAAGAGGCCAGACAAGATCATACCGTGCCCTAGGTGCAAAAGCATGGAGACTAAGTTTTGCTATTTCAACAATTACAATGTTAATCAGCCAAGACACTTTTGTAAAGGGTGTCA...

Protein

Download Protein FASTA

168 aa · LXL04_010343|LXL04_010343|OH1004|PROTEIN

MADVYKGDLDSTGIKLFGKMINVQAMRELKEEHASKSEIDDDDDQTLVNKRPDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKAKPPCGHGGLAESFSDISFFDDGTTTGGINFEGMMEWQLAAQGGFQHLFPAKRRRSSTGDF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010343`
TK1151 ID	TkA03G519950
OH-1004 ID	LXL04_010343
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010343

Location Chr02:144514602-144515108 (-)

Description Similar to DOF1.5: Dof zinc finger protein DOF1.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g29160`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At2g34140`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	No verified direct reference in this release
`At5g62430`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence.	No verified direct reference in this release
`At5g39660`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	Arabidopsis DOF transcription factors act redundantly to reduce CONSTANS expression and are essential for a photoperiodic flowering response.2009 · DOI: 10.1016/j.devcel.2009.06.015
`At3g47500`	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010343 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0009908 flower development Biological Process

GO:0010214 seed coat development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048510 regulation of timing of transition from vegetative to reproductive phase Biological Process

GO:1902455 negative regulation of stem cell population maintenance Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G29160

ath:AT2G34140

ath:AT3G47500

ath:AT5G39660

ath:AT5G62430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · LXL04_010343 · OH-1004

Cytoplasm0.237

Rank 2 · LXL04_010343 · OH-1004

Mitochondrion0.036

Rank 3 · LXL04_010343 · OH-1004

Cell membrane0.032

Rank 4 · LXL04_010343 · OH-1004

Endoplasmic reticulum0.020

Rank 5 · LXL04_010343 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02701.21Zn_ribbon_Dof54-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010343	`PF02701.21`	Zn_ribbon_Dof	54	109	8.3e-33	113.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P68350`	Arabidopsis thaliana	Dof zinc finger protein DOF1.5	55.030%	Swiss-Prot	strong database homology
`O22967`	Arabidopsis thaliana	Cyclic dof factor 4	54.217%	Swiss-Prot	strong database homology
`Q8W1E3`	Arabidopsis thaliana	Cyclic dof factor 1	56.075%	Swiss-Prot	moderate database homology
`Q93ZL5`	Arabidopsis thaliana	Cyclic dof factor 2	83.077%	Swiss-Prot	weak database homology
`Q8LFV3`	Arabidopsis thaliana	Cyclic dof factor 3	63.830%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card