LXL04_010231 | RubberDandelionOmics

Gene overview

LXL04_010231

Reference: OH-1004 Chr: Chr02 Coordinates: 142609906-142614122 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · LXL04_010231|LXL04_010231|OH1004|cDNA

ATGGGAGCCTTGGATGATGCTCACTACAATGCGGTGCTGGAAAATGGAGTGAAGCTTGGTGGTTGTGGTTTTGAGCAAGAACCAGAGACTTTAGCCATTGAAGATGTTGTGAAGGTTTTGTTACAGGGTTTGGGTGAAGACATCAATAGAGAAGGTATTAGAAAGACCCCTCTTCGTGTCGCTAAAGCCCTTCGTGAAGGAACCAGATGGTATAAACAGAACGTGAAAGACATAGTCCAAGGAAAGATGCAGTTTTCAGA...

CDS

Download CDS FASTA

648 bp · LXL04_010231|LXL04_010231|OH1004|CDS

ATGGGAGCCTTGGATGATGCTCACTACAATGCGGTGCTGGAAAATGGAGTGAAGCTTGGTGGTTGTGGTTTTGAGCAAGAACCAGAGACTTTAGCCATTGAAGATGTTGTGAAGGTTTTGTTACAGGGTTTGGGTGAAGACATCAATAGAGAAGGTATTAGAAAGACCCCTCTTCGTGTCGCTAAAGCCCTTCGTGAAGGAACCAGATGGTATAAACAGAACGTGAAAGACATAGTCCAAGGAAAGATGCAGTTTTCAGA...

Protein

Download Protein FASTA

215 aa · LXL04_010231|LXL04_010231|OH1004|PROTEIN

MGALDDAHYNAVLENGVKLGGCGFEQEPETLAIEDVVKVLLQGLGEDINREGIRKTPLRVAKALREGTRWYKQNVKDIVQGKMQFSDFGAFAVLDGFAPAIRIGYSYRIIARHIIGEQPNSVPRSILFEFINYTSDVVVWSSSRLVMCDYSLTENHCSDKKPIIVNWIEGHGNSVGCEAVIKKEVVVKVLKPSVAALVLLEGLMHPLAIQSPLFT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010231`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010231

Location Chr02:142609906-142614122 (-)

Description Similar to GCH1: GTP cyclohydrolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07270`	GTP cyclohydrolase 1 is the first enzyme in the biosynthetic pathway leading to folic acid.	Folate synthesis in plants: the first step of the pterin branch is mediated by a unique bimodular GTP cyclohydrolase I.2002 · DOI: 10.1073/pnas.192278499

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010231 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006729 tetrahydrobiopterin biosynthetic process Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0015936 coenzyme A metabolic process Biological Process

GO:0016104 triterpenoid biosynthetic process Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0016135 saponin biosynthetic process Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005778 peroxisomal membrane Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT3G07270

sly:543831

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.305

Rank 1 · LXL04_010231 · OH-1004

Nucleus0.240

Rank 2 · LXL04_010231 · OH-1004

Plastid0.221

Rank 3 · LXL04_010231 · OH-1004

Mitochondrion0.177

Rank 4 · LXL04_010231 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_010231 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01227.28GTP_cyclohydroI33-81 aa

PF00368.24HMG-CoA_red150-198 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010231	`PF01227.28`	GTP_cyclohydroI	33	81	7.5e-06	26.2
LXL04_010231	`PF00368.24`	HMG-CoA_red	150	198	1.8e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFV7`	Arabidopsis thaliana	GTP cyclohydrolase 1	65.116%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card