LXL04_010214 | RubberDandelionOmics

Gene overview

LXL04_010214

Reference: OH-1004 Chr: Chr02 Coordinates: 142353495-142353863 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

369 bp · LXL04_010214|LXL04_010214|OH1004|cDNA

ATGTTCGTGTGCGGGAATGTGGGGTTTTTCTCGATCGGAATCGGGCCGATATGTTGGGTTTTAAGCACCGAGATTTTCCCGTTACGGTTACGGTCACAGGCGTCGGCAATTGGGGTTGTCGGGAATAGGGTCATTAGTGGCATTGTGGCAATGTCGTTCCTTTCAATTGCTAGAAGAATCACAATGGGTGgtgttttctttctttttgcGATTATTTCGGGTTTTTCGGTTTTATTCGTTCACAATTATGTTCCGGAAAC...

CDS

Download CDS FASTA

369 bp · LXL04_010214|LXL04_010214|OH1004|CDS

ATGTTCGTGTGCGGGAATGTGGGGTTTTTCTCGATCGGAATCGGGCCGATATGTTGGGTTTTAAGCACCGAGATTTTCCCGTTACGGTTACGGTCACAGGCGTCGGCAATTGGGGTTGTCGGGAATAGGGTCATTAGTGGCATTGTGGCAATGTCGTTCCTTTCAATTGCTAGAAGAATCACAATGGGTGGTGTTTTCTTTCTTTTTGCGATTATTTCGGGTTTTTCGGTTTTATTCGTTCACAATTATGTTCCGGAAAC...

Protein

Download Protein FASTA

122 aa · LXL04_010214|LXL04_010214|OH1004|PROTEIN

MFVCGNVGFFSIGIGPICWVLSTEIFPLRLRSQASAIGVVGNRVISGIVAMSFLSIARRITMGGVFFLFAIISGFSVLFVHNYVPETKGKSLEQIETLFQGPWRELEIEEQRLVMTKSKYEV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010214`
TK1151 ID	TkA03G512050
OH-1004 ID	LXL04_010214
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010214

Location Chr02:142353495-142353863 (+)

Description Similar to PLT4: Probable polyol transporter 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20780`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At4g36670`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At3g18830`	Plasma membrane broad-spectrum sugar-proton symporter.	Analysis of transport activity of Arabidopsis sugar alcohol permease homolog AtPLT5.2005 · DOI: 10.1074/jbc.m410831200 Arabidopsis POLYOL TRANSPORTER5, a new member of the monosaccharide transporter-like superfamily, mediates H+-Symport of numerous substrates, including myo-inositol, glycerol, and ribose.2005 · DOI: 10.1105/tpc.104.026641
`At2g18480`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release
`At2g16120`	Plasma membrane sugar-proton symporter.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010214 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0010311 lateral root formation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0090406 pollen tube Cellular Component

GO:0005351 carbohydrate:proton symporter activity Molecular Function

GO:0005354 galactose transmembrane transporter activity Molecular Function

GO:0005365 myo-inositol transmembrane transporter activity Molecular Function

GO:0015145 monosaccharide transmembrane transporter activity Molecular Function

GO:0015148 D-xylose transmembrane transporter activity Molecular Function

GO:0015168 glycerol transmembrane transporter activity Molecular Function

GO:0015575 mannitol transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G16120

ath:AT2G18480

ath:AT2G20780

ath:AT3G18830

ath:AT4G36670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.345

Rank 1 · LXL04_010214 · OH-1004

Lysosome / Vacuole0.221

Rank 2 · LXL04_010214 · OH-1004

Endoplasmic reticulum0.174

Rank 3 · LXL04_010214 · OH-1004

Cytoplasm0.132

Rank 4 · LXL04_010214 · OH-1004

Golgi apparatus0.107

Rank 5 · LXL04_010214 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00083.31Sugar_tr2-99 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010214	`PF00083.31`	Sugar_tr	2	99	7.2e-23	81.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WUU6`	Arabidopsis thaliana	Probable polyol transporter 4	61.600%	Swiss-Prot	strong database homology
`Q8GXR2`	Arabidopsis thaliana	Probable polyol transporter 6	56.383%	Swiss-Prot	strong database homology
`Q8VZ80`	Arabidopsis thaliana	Polyol transporter 5	52.000%	Swiss-Prot	strong database homology
`Q9ZNS0`	Arabidopsis thaliana	Probable polyol transporter 3	56.989%	Swiss-Prot	strong database homology
`Q9XIH7`	Arabidopsis thaliana	Putative polyol transporter 1	49.462%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card