LXL04_010204 | RubberDandelionOmics

Gene overview

LXL04_010204

Reference: OH-1004 Chr: Chr02 Coordinates: 142104237-142105225 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

840 bp · LXL04_010204|LXL04_010204|OH1004|cDNA

ATGAAACCTCCCCACCTATTGATTAACAATGGCTGGTTATCTACATCTTACGGTTTGTGGTTCAGCTACTTTATGAGAGGGGACATACACGCGGTTGCCGGATTTGGCTGTCCAAGCATAGATCGGAAAGTTGTGAACTCCAGGAAACGTCTTAGGGCATACATTGGTATAGACGAAGGAAATGTTTGCAGCAGCTGCGATTTGAGGGGAAAGTGTGAAAGAGCATTTGTGAAGGCacgtgaagaagaagaagatggcCG...

CDS

Download CDS FASTA

840 bp · LXL04_010204|LXL04_010204|OH1004|CDS

ATGAAACCTCCCCACCTATTGATTAACAATGGCTGGTTATCTACATCTTACGGTTTGTGGTTCAGCTACTTTATGAGAGGGGACATACACGCGGTTGCCGGATTTGGCTGTCCAAGCATAGATCGGAAAGTTGTGAACTCCAGGAAACGTCTTAGGGCATACATTGGTATAGACGAAGGAAATGTTTGCAGCAGCTGCGATTTGAGGGGAAAGTGTGAAAGAGCATTTGTGAAGGCACGTGAAGAAGAAGAAGATGGCCG...

Protein

Download Protein FASTA

279 aa · LXL04_010204|LXL04_010204|OH1004|PROTEIN

MKPPHLLINNGWLSTSYGLWFSYFMRGDIHAVAGFGCPSIDRKVVNSRKRLRAYIGIDEGNVCSSCDLRGKCERAFVKAREEEEDGRTVDVMRFVLTYGLHHLNHSPDSKPYMNKRLEEAIRSLIRDMVKFSKTELDFDPSKCAPFVHRSDKNSCEYHERIESLGDNRDQAELKRGDWICIRCKFFNFAKNIKCLQCHTNPPKRQLNPGEWECRTSERRTVDGFASRFHNPYFLFSYLTSIPHMFVVAVNRYVSFFYSIC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010204`
TK1151 ID	TkA03G511250
OH-1004 ID	LXL04_010204
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 86.577 / OH-1004 92.473 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010204

Location Chr02:142104237-142105225 (+)

Description Similar to VAR3: Zinc finger protein VAR3, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g17790`	Probable component of some protein complex required for chloroplast and palisade cell development.	Arabidopsis VARIEGATED 3 encodes a chloroplast-targeted, zinc-finger protein required for chloroplast and palisade cell development.2004 · DOI: 10.1242/jcs.01360

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010204 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0009658 chloroplast organization Biological Process

GO:1900871 chloroplast mRNA modification Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT5G17790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · LXL04_010204 · OH-1004

Cytoplasm0.363

Rank 2 · LXL04_010204 · OH-1004

Endoplasmic reticulum0.108

Rank 3 · LXL04_010204 · OH-1004

Cell membrane0.105

Rank 4 · LXL04_010204 · OH-1004

Mitochondrion0.103

Rank 5 · LXL04_010204 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00641.24Zn_ribbon_RanBP175-199 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010204	`PF00641.24`	Zn_ribbon_RanBP	175	199	9.2e-07	28.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S9K3`	Arabidopsis thaliana	Zinc finger protein VAR3, chloroplastic	30.964%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card