LXL04_010040 | RubberDandelionOmics

Gene overview

LXL04_010040

Reference: OH-1004 Chr: Chr02 Coordinates: 138722264-138725789 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1950 bp · LXL04_010040|LXL04_010040|OH1004|cDNA

ttatacTCTTTCTGTGCAGGAAATTATGAAAAGGCGCGCCGATTGGATAGTAGTCAAAAAGACGAAACTGCCCATCTTGCTTATGTCTTTCTTCAAGTCCTACGGATTCTACGGATTCTCAGGCACCGGTTTTTAGAGACGGTTTCAAAGATTAAAATGTCGAAATCTTCACCGGCGGCTAAAAAGGCGAAGGAGGTGTCGCCGGAAGCAATTAAGCCCGACGAATACTCCCATAGCCCCGTTCACTACGCCGTTGCAGT...

CDS

Download CDS FASTA

1908 bp · LXL04_010040|LXL04_010040|OH1004|CDS

TTGGATAGTAGTCAAAAAGACGAAACTGCCCATCTTGCTTATGTCTTTCTTCAAGTCCTACGGATTCTACGGATTCTCAGGCACCGGTTTTTAGAGACGGTTTCAAAGATTAAAATGTCGAAATCTTCACCGGCGGCTAAAAAGGCGAAGGAGGTGTCGCCGGAAGCAATTAAGCCCGACGAATACTCCCATAGCCCCGTTCACTACGCCGTTGCAGTAGGTGATCATACAACCCTCTCACGTATCGTAGCCTCTTTACC...

Protein

Download Protein FASTA

635 aa · LXL04_010040|LXL04_010040|OH1004|PROTEIN

MDSSQKDETAHLAYVFLQVLRILRILRHRFLETVSKIKMSKSSPAAKKAKEVSPEAIKPDEYSHSPVHYAVAVGDHTTLSRIVASLPRLADPTRIHSESDSINQERLSDQIAAVLDRRDNPKRETPLHLAVRTNDTFAARALANAGADVSLQNADGWNALQEAVCRRCTDIVAILVQYHHVSAWSKWRRRLPRLLAVLRRMRDFYMEISFHFESSIVPFVGKIAPSDTYKIWKRDGNLRADTSLAGYDGLKIQRANQSFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010040`
TK1151 ID	TkA03G492550
OH-1004 ID	LXL04_010040
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 97.843 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_010040`
Location	Chr02:138722264-138725789 (+)
Description	Similar to ankrd13c-b: Ankyrin repeat domain-containing protein 13C-B
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_010040` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006612 protein targeting to membrane Biological Process GO:0006621 protein retention in ER lumen Biological Process GO:0071799 cellular response to prostaglandin D stimulus Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0048471 perinuclear region of cytoplasm Cellular Component GO:0005102 signaling receptor binding Molecular Function GO:0140597 protein carrier chaperone Molecular Function
KEGG gene cross-reference	dre:325167 hsa:81573 xla:379178 xla:431897 xtr:733949 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.286

Rank 1 · LXL04_010040 · OH-1004

Nucleus0.231

Rank 2 · LXL04_010040 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_010040 · OH-1004

Mitochondrion0.147

Rank 4 · LXL04_010040 · OH-1004

Endoplasmic reticulum0.142

Rank 5 · LXL04_010040 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12796.14Ank_2120-178 aa

PF11904.14ANKRD13_C239-610 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010040	`PF12796.14`	Ank_2	120	178	2.5e-10	41.5
LXL04_010040	`PF11904.14`	ANKRD13_C	239	610	2.8e-95	320.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card