LXL04_009904 | RubberDandelionOmics

Gene overview

LXL04_009904

Reference: OH-1004 Chr: Chr02 Coordinates: 135696290-135697728 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

465 bp · LXL04_009904|LXL04_009904|OH1004|cDNA

ATGGCATCCAGAGGAGGAGCAGTCGGAGGGAGGATACCGGAGCTGGAACAGTTGACCGTGGAACAGCTCAAATCAATCAAAGAACAAACCGATCTAGAAGTAAATCTTCTGCAAGACAGCCTCACAAACATCCGTACCGCTACTACTCGTCTCGATCTCGCTTCCATAGCTCTCCAAGATCTCTCTCTCCGACCTCAAGGGAAGAAAATGTTGGTTCCTTTGACGGCTTCCCTTTATGTTCCTGGCACCCTCGACGACGC...

CDS

Download CDS FASTA

465 bp · LXL04_009904|LXL04_009904|OH1004|CDS

ATGGCATCCAGAGGAGGAGCAGTCGGAGGGAGGATACCGGAGCTGGAACAGTTGACCGTGGAACAGCTCAAATCAATCAAAGAACAAACCGATCTAGAAGTAAATCTTCTGCAAGACAGCCTCACAAACATCCGTACCGCTACTACTCGTCTCGATCTCGCTTCCATAGCTCTCCAAGATCTCTCTCTCCGACCTCAAGGGAAGAAAATGTTGGTTCCTTTGACGGCTTCCCTTTATGTTCCTGGCACCCTCGACGACGC...

Protein

Download Protein FASTA

154 aa · LXL04_009904|LXL04_009904|OH1004|PROTEIN

MASRGGAVGGRIPELEQLTVEQLKSIKEQTDLEVNLLQDSLTNIRTATTRLDLASIALQDLSLRPQGKKMLVPLTASLYVPGTLDDAEKVLVDVGTGYFIEKTMEEGKDYCERKINLLKSNYDQLLEVASKKKNIADEAGIVLQAKLKQLSAAS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009904`
TK1151 ID	TkA03G481490
OH-1004 ID	LXL04_009904
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009904

Location Chr02:135696290-135697728 (-)

Description Similar to At5g23290: Probable prefoldin subunit 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23290`	Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it.	Prefoldins 3 and 5 play an essential role in Arabidopsis tolerance to salt stress.2009 · DOI: 10.1093/mp/ssp016

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009904 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006397 mRNA processing Biological Process

GO:0006457 protein folding Biological Process

GO:0009409 response to cold Biological Process

GO:0009631 cold acclimation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0043622 cortical microtubule organization Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0050821 protein stabilization Biological Process

GO:0071370 cellular response to gibberellin stimulus Biological Process

GO:0090090 negative regulation of canonical Wnt signaling pathway Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

KEGG gene cross-reference

ath:AT5G23290

bta:282848

hsa:5204

mmu:56612

pon:100172545

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.692

Rank 1 · LXL04_009904 · OH-1004

Nucleus0.409

Rank 2 · LXL04_009904 · OH-1004

Peroxisome0.091

Rank 3 · LXL04_009904 · OH-1004

Mitochondrion0.074

Rank 4 · LXL04_009904 · OH-1004

Cell membrane0.059

Rank 5 · LXL04_009904 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02996.23Prefoldin33-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009904	`PF02996.23`	Prefoldin	33	148	1.4e-29	103.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P57742`	Arabidopsis thaliana	Prefoldin subunit 5	78.723%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card