LXL04_009897 | RubberDandelionOmics

Gene overview

LXL04_009897

Reference: OH-1004 Chr: Chr02 Coordinates: 135631644-135634976 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1246 bp · LXL04_009897|LXL04_009897|OH1004|cDNA

TATATTCGCCGCTGTCTAGAGATGAATTTACACGCGAGCGGAGTAACGATCTTCAGAGGGTTTCTCGGAACTACGACCCAAACCTTCGTCCGCAAGAGAAGGCGGTGGAGTATGTTAGAGCCCTTAATGCAGCTAAATTGGATAAGGTATTTGCAAATTGCAAGACCATTTATTGGAGCCATGGATGGGCATATAGACGCCATTTCATGTATGGCCAAAAACCCTAGTCACCTGAAAGGTCTATTTTCTGGTTCTATGGA...

CDS

Download CDS FASTA

642 bp · LXL04_009897|LXL04_009897|OH1004|CDS

TTGTGTAGCGATCGGAGCATAACAATCTATGATCTCCGTACATCATCACCAGCTAGAAAACTTATCATGAGGACAAAAACTAATTCCATTGCTTGGAATCCAATGGAGCCCATGAACTTTACAGCTGCAAATGAAAACTGCAACTGTTACAGTTTTGATGCAAGAAAACTAGAAGAAGCCAATATGGATATCGATTACTCACCAACCGGTCGTGAATTTGTAACCGGATCTTATGACAGAACAGTGAGGATTTTTCAGTA...

Protein

Download Protein FASTA

213 aa · LXL04_009897|LXL04_009897|OH1004|PROTEIN

MCSDRSITIYDLRTSSPARKLIMRTKTNSIAWNPMEPMNFTAANENCNCYSFDARKLEEANMDIDYSPTGREFVTGSYDRTVRIFQYNGGHSREIYHTKRMQRVFCVKFSGDASYVISGSDDTNLRLWKANASEQLGVILPREHKKHEYMEAVKNRYKHLPEVKRILRHRHLPRPIYKADAEKRKEDRRRAHSAPGSMPRKSIRKNRIIQEIE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009897`
TK1151 ID	TkA03G481200
OH-1004 ID	LXL04_009897
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 52.113 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009897`
Location	Chr02:135631644-135634976 (+)
Description	Similar to DCAF13: DDB1- and CUL4-associated factor 13
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009897` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0006364 rRNA processing Biological Process GO:0007056 spindle assembly involved in female meiosis Biological Process GO:0016567 protein ubiquitination Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0044725 epigenetic programming in the zygotic pronuclei Biological Process GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0005813 centrosome Cellular Component GO:0005829 cytosol Cellular Component GO:0030054 cell junction Cellular Component
KEGG gene cross-reference	dre:393097 gga:420263 mmu:223499 xtr:407967 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.780

Rank 1 · LXL04_009897 · OH-1004

Cytoplasm0.194

Rank 2 · LXL04_009897 · OH-1004

Cell membrane0.040

Rank 3 · LXL04_009897 · OH-1004

Mitochondrion0.025

Rank 4 · LXL04_009897 · OH-1004

Endoplasmic reticulum0.015

Rank 5 · LXL04_009897 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23414.2Beta-prop_EML_22-136 aa

PF23381.2Beta-prop_IFT122_1st3-134 aa

PF25174.2Beta-prop_THOC34-139 aa

PF25173.2Beta-prop_WDR3_1st62-135 aa

PF00400.39WD4063-85 aa

PF25175.2Beta-prop_WDR563-139 aa

PF24814.2WD40_Prp1964-145 aa

PF25391.2WD40_Gbeta64-140 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009897	`PF23414.2`	Beta-prop_EML_2	2	136	1e-10	42.2
LXL04_009897	`PF23381.2`	Beta-prop_IFT122_1st	3	134	1.5e-14	54.8
LXL04_009897	`PF25174.2`	Beta-prop_THOC3	4	139	1.1e-14	54.8
LXL04_009897	`PF25173.2`	Beta-prop_WDR3_1st	62	135	6.1e-09	36.6
LXL04_009897	`PF00400.39`	WD40	63	85	1.2e-13	51.6
LXL04_009897	`PF25175.2`	Beta-prop_WDR5	63	139	7.2e-13	49.2
LXL04_009897	`PF24814.2`	WD40_Prp19	64	145	1.6e-09	38.0
LXL04_009897	`PF25391.2`	WD40_Gbeta	64	140	5.3e-07	29.7
LXL04_009897	`PF24817.2`	WD40_WDHD1_1st	69	134	1e-07	32.1
LXL04_009897	`PF24807.2`	WD40_CDC20-Fz	70	136	1.9e-06	28.1
LXL04_009897	`PF00400.39`	WD40	103	128	1.2e-13	51.6
LXL04_009897	`PF04158.20`	Sof1	130	208	3.8e-24	85.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card