Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1674 bp · LXL04_009885|LXL04_009885|OH1004|cDNA
ATGGGGTTGAAGGTGAAAGAATTTAGGGCTTTCTTCGGATTGTTGTGGTTTGGTCTGTTAATTTTTCAGCCGGTTGCAGGATTAAGACCTCTGAGGGAGAGTGCTCGTTCATGGGGGGATGAGTGGCTTGTTGGAAGGAAAGATGAGAACGAAGTGGGCCCATTCACTGCATGGAATATAACCGGGACATATAGAGGGGCTTGGAGGTTTATGCAGTCCTCAAATACCTCTTCCAGGTTTCCAGATTTTAAGAAATCAAG...
1674 bp · LXL04_009885|LXL04_009885|OH1004|CDS
ATGGGGTTGAAGGTGAAAGAATTTAGGGCTTTCTTCGGATTGTTGTGGTTTGGTCTGTTAATTTTTCAGCCGGTTGCAGGATTAAGACCTCTGAGGGAGAGTGCTCGTTCATGGGGGGATGAGTGGCTTGTTGGAAGGAAAGATGAGAACGAAGTGGGCCCATTCACTGCATGGAATATAACCGGGACATATAGAGGGGCTTGGAGGTTTATGCAGTCCTCAAATACCTCTTCCAGGTTTCCAGATTTTAAGAAATCAAG...
Protein
Download Protein FASTA557 aa · LXL04_009885|LXL04_009885|OH1004|PROTEIN
MGLKVKEFRAFFGLLWFGLLIFQPVAGLRPLRESARSWGDEWLVGRKDENEVGPFTAWNITGTYRGAWRFMQSSNTSSRFPDFKKSSGNSVLELMTRPTKINGVHYVQGVMIFHDVFDNEPEVGRVQIRVEGVYIWPFRQLRMVANSGRDGEFGQEEDYILSNPYHLLGVFSSQVFQESPRDKIWKSKQSPITDMDKHCNIEISAQISRVSSTQSDGEHDRYYLQGLMESPSADDDGDCFSPMIMNATSVNIEVYYNKAV...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_009885 |
|---|---|
| TK1151 ID | TkA03G480010 |
| OH-1004 ID | LXL04_009885 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.600 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_009885 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:135348791-135352275 (+) | |||||||||
| Description | Similar to FLY1: Transmembrane E3 ubiquitin-protein ligase FLY1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009827 plant-type cell wall modification Biological Process GO:0016567 protein ubiquitination Biological Process GO:0032933 SREBP signaling pathway Biological Process GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process GO:0043162 ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway Biological Process GO:0048358 mucilage pectin biosynthetic process Biological Process GO:0048363 mucilage pectin metabolic process Biological Process GO:0051603 proteolysis involved in protein catabolic process Biological Process GO:0080001 mucilage extrusion from seed coat Biological Process GO:0140624 EGAD pathway Biological Process GO:0000139 Golgi membrane Cellular Component | |||||||||
| KEGG gene cross-reference | afm:AFUA_1G12080 ath:AT2G20650 ath:AT4G28370 sce:YKL034W spo:2541251 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF11145.15DUF2921251-485 aaPF13639.13zf-RING_2506-551 aaPF13923.13zf-C3HC4_2507-550 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_009885 | PF11145.15 | DUF2921 | 251 | 485 | 2.7e-99 | 332.3 |
| LXL04_009885 | PF13639.13 | zf-RING_2 | 506 | 551 | 7.8e-11 | 42.8 |
| LXL04_009885 | PF13923.13 | zf-C3HC4_2 | 507 | 550 | 7.8e-06 | 26.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.