LXL04_009879 | RubberDandelionOmics

Gene overview

LXL04_009879

Reference: OH-1004 Chr: Chr02 Coordinates: 135303518-135305909 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · LXL04_009879|LXL04_009879|OH1004|cDNA

ATGGTTAAATCAACCATGGGTAACAATAAATTGCTTTATCCAGTACTTGGATTTGCAGCTTGTCTTGTTTTTCTTTACCTGTCTTTTGGGGATTTCTTATCAGTAAATTACAAAACTGACCCAAAATTGAGTTTTGTGGAGAGGAATGGGACTAATTTCGTCGTGGATGGTAAACCTTTTTACGTCAATGGTTGGAATTCGTATTGGTTCATGGATCACGCTGTTCATGATTATAGCCGTCCAAGAATCAGAGAAATGCT...

CDS

Download CDS FASTA

1311 bp · LXL04_009879|LXL04_009879|OH1004|CDS

ATGGTTAAATCAACCATGGGTAACAATAAATTGCTTTATCCAGTACTTGGATTTGCAGCTTGTCTTGTTTTTCTTTACCTGTCTTTTGGGGATTTCTTATCAGTAAATTACAAAACTGACCCAAAATTGAGTTTTGTGGAGAGGAATGGGACTAATTTCGTCGTGGATGGTAAACCTTTTTACGTCAATGGTTGGAATTCGTATTGGTTCATGGATCACGCTGTTCATGATTATAGCCGTCCAAGAATCAGAGAAATGCT...

Protein

Download Protein FASTA

436 aa · LXL04_009879|LXL04_009879|OH1004|PROTEIN

MVKSTMGNNKLLYPVLGFAACLVFLYLSFGDFLSVNYKTDPKLSFVERNGTNFVVDGKPFYVNGWNSYWFMDHAVHDYSRPRIREMLQAAAKMGLTVCRTWAFNDGDYNALQIAPGQFDERVFKALDYVIAESRQVGVRLLFSLVNNLQAYGGKTQYVKWAWDEGVGLSASNDSFFFDPSIRLYFKNYVKTILTRKNSITGVVYRDDPTIFGWELINEPRCITDASGDTLQDWIEEMSSFIKSIDRKHMLTIGLEGFYGP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009879`
TK1151 ID	TkA03G479890
OH-1004 ID	LXL04_009879
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009879

Location Chr02:135303518-135305909 (+)

Description Similar to MAN2: Mannan endo-1,4-beta-mannosidase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g20680`	Mannan endo-1,4-beta-mannosidase 2.	No verified direct reference in this release
`At4g28320`	Mannan endo-1,4-beta-mannosidase 5.	No verified direct reference in this release
`At5g01930`	Mannan endo-1,4-beta-mannosidase 6.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0746700`	Mannan endo-1,4-beta-mannosidase 2.	No verified direct reference in this release
`Os06g0311600`	Mannan endo-1,4-beta-mannosidase 6.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009879 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0009845 seed germination Biological Process

GO:0010412 mannan metabolic process Biological Process

GO:1903927 response to cyanide Biological Process

GO:0000138 Golgi trans cisterna Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016985 mannan endo-1,4-beta-mannosidase activity Molecular Function

KEGG gene cross-reference

ath:AT2G20680

ath:AT4G28320

ath:AT5G01930

dosa:Os01g0746700

dosa:Os06g0311600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.291

Rank 1 · LXL04_009879 · OH-1004

Lysosome / Vacuole0.280

Rank 2 · LXL04_009879 · OH-1004

Endoplasmic reticulum0.178

Rank 3 · LXL04_009879 · OH-1004

Cytoplasm0.126

Rank 4 · LXL04_009879 · OH-1004

Extracellular0.122

Rank 5 · LXL04_009879 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26410.1GH5_mannosidase44-382 aa

PF00150.25Cellulase57-356 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009879	`PF26410.1`	GH5_mannosidase	44	382	4.8e-54	184.5
LXL04_009879	`PF00150.25`	Cellulase	57	356	1.3e-09	38.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7Y223`	Arabidopsis thaliana	Mannan endo-1,4-beta-mannosidase 2	68.545%	Swiss-Prot	strong database homology
`Q9M0H6`	Arabidopsis thaliana	Mannan endo-1,4-beta-mannosidase 5	68.779%	Swiss-Prot	strong database homology
`Q9LZV3`	Arabidopsis thaliana	Mannan endo-1,4-beta-mannosidase 6	48.118%	Swiss-Prot	moderate database homology
`Q0JJD4`	Oryza sativa subsp. japonica	Mannan endo-1,4-beta-mannosidase 2	55.631%	Swiss-Prot	strong database homology
`Q0DCM5`	Oryza sativa subsp. japonica	Mannan endo-1,4-beta-mannosidase 6	49.351%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card