LXL04_009829 | RubberDandelionOmics

Gene overview

LXL04_009829

Reference: OH-1004 Chr: Chr02 Coordinates: 134407306-134411512 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

312 bp · LXL04_009829|LXL04_009829|OH1004|cDNA

ATGGCTATTTGTATTCCTCGGGTGATTCAGGCAAAAAAAGTTCCTTGTAGATCACCGTCAAGTGGAAGCCGATCATCATCATTCAAGGACATCACCCCCAAAGGCCATTTTGCAGTTTATGTTGGCGAGCATGATGAGAAAAAACGATTTGTTGTTCCTATATCATTATTAAACCAACCTTCATTCCAAGACTTGCTACGTCAAGCAGAGGAAGAATTCGGATATGATCATCCAATGGGTGGCCTCACAATTCCGTGTCA...

CDS

Download CDS FASTA

312 bp · LXL04_009829|LXL04_009829|OH1004|CDS

ATGGCTATTTGTATTCCTCGGGTGATTCAGGCAAAAAAAGTTCCTTGTAGATCACCGTCAAGTGGAAGCCGATCATCATCATTCAAGGACATCACCCCCAAAGGCCATTTTGCAGTTTATGTTGGCGAGCATGATGAGAAAAAACGATTTGTTGTTCCTATATCATTATTAAACCAACCTTCATTCCAAGACTTGCTACGTCAAGCAGAGGAAGAATTCGGATATGATCATCCAATGGGTGGCCTCACAATTCCGTGTCA...

Protein

Download Protein FASTA

104 aa · LXL04_009829|LXL04_009829|OH1004|PROTEIN

MAICIPRVIQAKKVPCRSPSSGSRSSSFKDITPKGHFAVYVGEHDEKKRFVVPISLLNQPSFQDLLRQAEEEFGYDHPMGGLTIPCHEDVFIDVVSQKRRTFHI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009829`
TK1151 ID	TkA03G476110
OH-1004 ID	LXL04_009829
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	64.600
Protein coverage (%)	TK1151 96.078 / OH-1004 91.346 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009829

Location Chr02:134407306-134411512 (+)

Description No functional description available

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g18020`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At5g18050`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At5g18080`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release
`At4g38850`	Functions as a positive effector of cell expansion through modulation of auxin transport.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009829 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT4G38850

ath:AT5G18020

ath:AT5G18050

ath:AT5G18080

gmx:100787768

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · LXL04_009829 · OH-1004

Nucleus0.348

Rank 2 · LXL04_009829 · OH-1004

Cell membrane0.247

Rank 3 · LXL04_009829 · OH-1004

Endoplasmic reticulum0.077

Rank 4 · LXL04_009829 · OH-1004

Plastid0.043

Rank 5 · LXL04_009829 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02519.21Auxin_inducible20-96 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009829	`PF02519.21`	Auxin_inducible	20	96	3.6e-23	82.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FJG0`	Arabidopsis thaliana	Auxin-responsive protein SAUR20	65.385%	Swiss-Prot	strong database homology
`Q9FJF7`	Arabidopsis thaliana	Auxin-responsive protein SAUR22	65.333%	Swiss-Prot	strong database homology
`Q9FK62`	Arabidopsis thaliana	Auxin-responsive protein SAUR24	58.889%	Swiss-Prot	strong database homology
`Q41220`	Arabidopsis thaliana	Auxin-responsive protein SAUR15	71.642%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card