LXL04_009774 | RubberDandelionOmics

Gene overview

LXL04_009774

Reference: OH-1004 Chr: Chr02 Coordinates: 133142512-133143978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

711 bp · LXL04_009774|LXL04_009774|OH1004|cDNA

ATGCCAAAGCCCAAACAGTACCCAAACAGGCGATTAAGCCTAATTCGTCTCAACGGCTCTCCGCCTTTGTTTTGGCGACCTCACTCACTCTTCTCCACTCCGACGGCCGCGACTGAGCCTCTAACCAGATCACCCATTCACCCTCCACTTTTTTTTTTCTGCTCCGCGGCACTGCCGACTGTTACCCTGAACTCTCTATATCTCGCGTTTTTGAGGCGATATCTTTTCTCAATCGGTTTGGTTGCAGCTGTGCAGCTGCT...

CDS

Download CDS FASTA

711 bp · LXL04_009774|LXL04_009774|OH1004|CDS

ATGCCAAAGCCCAAACAGTACCCAAACAGGCGATTAAGCCTAATTCGTCTCAACGGCTCTCCGCCTTTGTTTTGGCGACCTCACTCACTCTTCTCCACTCCGACGGCCGCGACTGAGCCTCTAACCAGATCACCCATTCACCCTCCACTTTTTTTTTTCTGCTCCGCGGCACTGCCGACTGTTACCCTGAACTCTCTATATCTCGCGTTTTTGAGGCGATATCTTTTCTCAATCGGTTTGGTTGCAGCTGTGCAGCTGCT...

Protein

Download Protein FASTA

236 aa · LXL04_009774|LXL04_009774|OH1004|PROTEIN

MPKPKQYPNRRLSLIRLNGSPPLFWRPHSLFSTPTAATEPLTRSPIHPPLFFFCSAALPTVTLNSLYLAFLRRYLFSIGLVAAVQLLLVELAAQSIVMMRCYTMLFLIVVEMNKKEVFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIERINAGTRVHGVNYGNFMHGLVKENIQINRKVLSELSMHEPYSFKALVDVSRTAFPGNRQVAATPKKEGLQILV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009774`
TK1151 ID	TkA03G471010
OH-1004 ID	LXL04_009774
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009774`
Location	Chr02:133142512-133143978 (-)
Description	Similar to rplT: 50S ribosomal protein L20 (Rhodospirillum centenum (strain ATCC 51521 / SW)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009774` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000027 ribosomal large subunit assembly Biological Process GO:0006412 translation Biological Process GO:0005840 ribosome Cellular Component GO:1990904 ribonucleoprotein complex Cellular Component GO:0003735 structural constituent of ribosome Molecular Function GO:0019843 rRNA binding Molecular Function
KEGG gene cross-reference	ecn:Ecaj_0134 mes:Meso_0674 met:M446_5320 mpo:Mpop_1608 rce:RC1_2313 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.871

Rank 1 · LXL04_009774 · OH-1004

Mitochondrion0.147

Rank 2 · LXL04_009774 · OH-1004

Cytoplasm0.044

Rank 3 · LXL04_009774 · OH-1004

Nucleus0.039

Rank 4 · LXL04_009774 · OH-1004

Peroxisome0.012

Rank 5 · LXL04_009774 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00453.24Ribosomal_L20113-209 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009774	`PF00453.24`	Ribosomal_L20	113	209	4.5e-41	140.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card