LXL04_009773 | RubberDandelionOmics

Gene overview

LXL04_009773

Reference: OH-1004 Chr: Chr02 Coordinates: 133077481-133078642 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

898 bp · LXL04_009773|LXL04_009773|OH1004|cDNA

GGTGAAAGCATAAGTTGTTCATATCTTGATGTTGTACCGTACTACTTACTCATCATCCATTTCTTTCCTTTCTTCCTCTTTCGCTTCCCAAAGAGTTTCTGGTGAACTTTGTTGTTTTAGATAGAGAAAGcttctagagagagaaaatcAGAGATCTGACTCATtattgaagatgatgaagagatgtgAGCTTTGTAAATCTTTCGCCAGGATACATTGCCAATCAGATCAAGCTAGTTTGTGCTGGAGCTGCGATGCAA...

CDS

Download CDS FASTA

732 bp · LXL04_009773|LXL04_009773|OH1004|CDS

TTGAAGATGATGAAGAGATGTGAGCTTTGTAAATCTTTCGCCAGGATACATTGCCAATCAGATCAAGCTAGTTTGTGCTGGAGCTGCGATGCAAAGGTTCATTCGGCGAATTTTCTAGTAGCTAAGCATTCGAGGTGTCTTTTGTGTCATTCATGCCAGTCTCCGACCCGGTGGACTGCATCCGGTAAGAAACTTGAGCCTGCAACGGTGTCGATCTGCGATAGGTGTGTTGTTAACGGTACTTTTGACGATGATGGAAC...

Protein

Download Protein FASTA

243 aa · LXL04_009773|LXL04_009773|OH1004|PROTEIN

MKMMKRCELCKSFARIHCQSDQASLCWSCDAKVHSANFLVAKHSRCLLCHSCQSPTRWTASGKKLEPATVSICDRCVVNGTFDDDGTGTDGDEQYDGDEDETDLDHREVRDNNHVVTWSSTPPPPASSSSGSEEFGIADRYVSMKRQRQNVADLSCAVDHNCSLVQIKRRKRTSTVTEPAIRDDEAAQIHSLPSRSESIVRMLNRNRNVNMISDDNESTTVVGKSKSTRAVGFEFDLNSYPSL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009773`
TK1151 ID	TkA03G470680
OH-1004 ID	LXL04_009773
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.600
Protein coverage (%)	TK1151 87.410 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009773

Location Chr02:133077481-133078642 (-)

Description Similar to BBX32: B-box zinc finger protein 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g21150`	Repressor of light-mediated regulation of seedling development.	BBX32, an Arabidopsis B-Box protein, functions in light signaling by suppressing HY5-regulated gene expression and interacting with STH2/BBX21.2011 · DOI: 10.1104/pp.111.177139
`At1g68190`	Putative zinc finger protein At1g68190.	No verified direct reference in this release
`At3g21890`	Developmental regulator acting by forming heterodimeric complexes, that sequester CO and CO-like (COL) proteins into non-functional complexes.	MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005959
`At5g24930`	Zinc finger protein CONSTANS-LIKE 4.	No verified direct reference in this release
`At4g15248`	Developmental regulator acting by forming heterodimeric complexes, that sequester CO and CO-like (COL) proteins into non-functional complexes.	MicroProtein-Mediated Recruitment of CONSTANS into a TOPLESS Trimeric Complex Represses Flowering in Arabidopsis.2016 · DOI: 10.1371/journal.pgen.1005959

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009773 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009640 photomorphogenesis Biological Process

GO:0009785 blue light signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0010224 response to UV-B Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G68190

ath:AT3G21150

ath:AT3G21890

ath:AT4G15248

ath:AT5G24930

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.951

Rank 1 · LXL04_009773 · OH-1004

Cytoplasm0.118

Rank 2 · LXL04_009773 · OH-1004

Cell membrane0.030

Rank 3 · LXL04_009773 · OH-1004

Endoplasmic reticulum0.018

Rank 4 · LXL04_009773 · OH-1004

Plastid0.011

Rank 5 · LXL04_009773 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LJB7`	Arabidopsis thaliana	B-box zinc finger protein 32	49.206%	Swiss-Prot	weak database homology
`Q9C9F4`	Arabidopsis thaliana	Putative zinc finger protein At1g68190	50.943%	Swiss-Prot	weak database homology
`Q9LRM4`	Arabidopsis thaliana	B-box domain protein 31	50.877%	Swiss-Prot	weak database homology
`Q940T9`	Arabidopsis thaliana	Zinc finger protein CONSTANS-LIKE 4	43.836%	Swiss-Prot	weak database homology
`Q1G3I2`	Arabidopsis thaliana	B-box domain protein 30	46.429%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card