LXL04_009772 | RubberDandelionOmics

Gene overview

LXL04_009772

Reference: OH-1004 Chr: Chr02 Coordinates: 133052550-133054350 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1582 bp · LXL04_009772|LXL04_009772|OH1004|cDNA

AAAGTCGTTCACATATCTCAGGATCAAGTTAAAACCTTAAACCAAAAAAATGACCGAAACAACAGGACAAATGAGAAAAAGCGTGTCCCTCGGAAATAACCTCGTAGACTACGATGGAAGAACATCTGCAGATGAGTCCGACTACACAAGCTCTCATAACACCCATACCGAATCCATAAACGACCTCACTGATAAAGACGAAAAAGACCCCGAATACCAAAAATCCACTTCGCTTCCAGTAAGTTCTAATCCCGTTCTCC...

CDS

Download CDS FASTA

1533 bp · LXL04_009772|LXL04_009772|OH1004|CDS

ATGACCGAAACAACAGGACAAATGAGAAAAAGCGTGTCCCTCGGAAATAACCTCGTAGACTACGATGGAAGAACATCTGCAGATGAGTCCGACTACACAAGCTCTCATAACACCCATACCGAATCCATAAACGACCTCACTGATAAAGACGAAAAAGACCCCGAATACCAAAAATCCACTTCGCTTCCAGTAAGTTCTAATCCCGTTCTCCACGAATCGGCATCTTCCGGATGCCACCAATCCGATGATGAAATCATTGA...

Protein

Download Protein FASTA

510 aa · LXL04_009772|LXL04_009772|OH1004|PROTEIN

MTETTGQMRKSVSLGNNLVDYDGRTSADESDYTSSHNTHTESINDLTDKDEKDPEYQKSTSLPVSSNPVLHESASSGCHQSDDEIIEFESKFPEHHHPPLVKSNSLPFLESSFSKLVDQSQSSDDLKAFERVTADDSSDSCNHVGSAKDWILPVADESGKDKTFQEDYKGHNMSRLANKDYKTKRIEKWVMDLHYTPASEVNKAVNLDPRGKNVRTAILDCTATSKTGTKAFRGMDAAKSYISSLSASSSSAHLVNHGLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009772`
TK1151 ID	TkA06G059050
OH-1004 ID	LXL04_009772
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	52.200
Protein coverage (%)	TK1151 85.358 / OH-1004 98.431 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009772`
Location	Chr02:133052550-133054350 (-)
Description	Similar to sds-22: Protein phosphatase 1 regulatory subunit SDS22 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009772` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0003341 cilium movement Biological Process GO:0007059 chromosome segregation Biological Process GO:0030317 flagellated sperm motility Biological Process GO:0046600 negative regulation of centriole replication Biological Process GO:0051301 cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005813 centrosome Cellular Component GO:0005814 centriole Cellular Component GO:0005929 cilium Cellular Component GO:0005930 axoneme Cellular Component GO:0036126 sperm flagellum Cellular Component
KEGG gene cross-reference	cel:CELE_T09A5.9 ddi:DDB_G0284039 hsa:83450 xla:431936 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.454

Rank 1 · LXL04_009772 · OH-1004

Cell membrane0.330

Rank 2 · LXL04_009772 · OH-1004

Nucleus0.298

Rank 3 · LXL04_009772 · OH-1004

Golgi apparatus0.064

Rank 4 · LXL04_009772 · OH-1004

Endoplasmic reticulum0.058

Rank 5 · LXL04_009772 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8270-325 aa

PF14580.13LRR_9272-364 aa

PF12799.14LRR_4293-328 aa

PF13855.13LRR_8314-370 aa

PF12799.14LRR_4337-372 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009772	`PF13855.13`	LRR_8	270	325	1.3e-15	57.6
LXL04_009772	`PF14580.13`	LRR_9	272	364	3e-08	34.1
LXL04_009772	`PF12799.14`	LRR_4	293	328	1e-14	54.9
LXL04_009772	`PF13855.13`	LRR_8	314	370	1.3e-15	57.6
LXL04_009772	`PF12799.14`	LRR_4	337	372	1e-14	54.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card