LXL04_009712 | RubberDandelionOmics

Gene overview

LXL04_009712

Reference: OH-1004 Chr: Chr02 Coordinates: 131967400-131970214 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2405 bp · LXL04_009712|LXL04_009712|OH1004|cDNA

GAAAAAGAAACCTCATCATGTTTGGATCTATCAAAGATAACTTTCTTGATTTCGATGCTCCTATTATGTCTTCTTCAACCCTATTGGATTTTTCACCTTCTTACTTTAGTCCCAACTCATTCATGGGATGTTTTGATCCGGTCGTTTCTCCGGATGAAACAGATATGAACCTTCTAGATGATTACCAAGAATTCTTCAATTATCGATTGATTCAAGCCATTGAATATCTAAATGAAAGATGCATAATGGACACAGACCTT...

CDS

Download CDS FASTA

2388 bp · LXL04_009712|LXL04_009712|OH1004|CDS

ATGTTTGGATCTATCAAAGATAACTTTCTTGATTTCGATGCTCCTATTATGTCTTCTTCAACCCTATTGGATTTTTCACCTTCTTACTTTAGTCCCAACTCATTCATGGGATGTTTTGATCCGGTCGTTTCTCCGGATGAAACAGATATGAACCTTCTAGATGATTACCAAGAATTCTTCAATTATCGATTGATTCAAGCCATTGAATATCTAAATGAAAGATGCATAATGGACACAGACCTTCTTCTTCAGCTATGGCT...

Protein

Download Protein FASTA

795 aa · LXL04_009712|LXL04_009712|OH1004|PROTEIN

MFGSIKDNFLDFDAPIMSSSTLLDFSPSYFSPNSFMGCFDPVVSPDETDMNLLDDYQEFFNYRLIQAIEYLNERCIMDTDLLLQLWLPVITHGKQVLTTVNTSFIMNSDNTNLSNYREVSKNHQFPADYESTEMIGLPSHVFLKKFPTFTPDLQFVAEGNDPRVIYAQNLNLCGCLNLPVFEVDGGTCLGVVEVVSTSRKVNFREELENICKALEAVDLRTSEFLMHSTQKEFIEPYDAVFVEIRDVLRTICNTLNLPLA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009712`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009712

Location Chr02:131967400-131970214 (+)

Description Similar to NLP1: Protein NLP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17150`	Probable transcription factor.	No verified direct reference in this release
`At1g20640`	Probable transcription factor.	No verified direct reference in this release
`At1g76350`	Probable transcription factor.	No verified direct reference in this release
`At4g35270`	Probable transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0131100`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009712 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0010167 response to nitrate Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0090548 response to nitrate starvation Biological Process

GO:0097009 energy homeostasis Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT1G20640

ath:AT1G76350

ath:AT2G17150

ath:AT4G35270

dosa:Os03g0131100

osa:4331508

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.898

Rank 1 · LXL04_009712 · OH-1004

Cytoplasm0.153

Rank 2 · LXL04_009712 · OH-1004

Cell membrane0.048

Rank 3 · LXL04_009712 · OH-1004

Endoplasmic reticulum0.030

Rank 4 · LXL04_009712 · OH-1004

Plastid0.020

Rank 5 · LXL04_009712 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22922.3GAF_NLP235-388 aa

PF02042.22RWP-RK510-582 aa

PF00564.31PB1694-776 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009712	`PF22922.3`	GAF_NLP	235	388	1.1e-49	169.0
LXL04_009712	`PF02042.22`	RWP-RK	510	582	1.1e-25	90.3
LXL04_009712	`PF00564.31`	PB1	694	776	3.9e-19	69.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H111`	Arabidopsis thaliana	Protein NLP1	39.796%	Swiss-Prot	moderate database homology
`Q9LE38`	Arabidopsis thaliana	Protein NLP4	37.738%	Swiss-Prot	moderate database homology
`Q9SFW8`	Arabidopsis thaliana	Protein NLP5	39.018%	Swiss-Prot	moderate database homology
`Q7X9B9`	Arabidopsis thaliana	Protein NLP2	43.174%	Swiss-Prot	moderate database homology
`Q10S83`	Oryza sativa subsp. japonica	Protein NLP1	36.524%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card