LXL04_009631 | RubberDandelionOmics

Gene overview

LXL04_009631

Reference: OH-1004 Chr: Chr02 Coordinates: 130005398-130006732 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

759 bp · LXL04_009631|LXL04_009631|OH1004|cDNA

ATGATTCTTCACTTTTTGTTATCATTAACGTGTCCTTCCACAGTTGTCAGGTGTCAATCTGACTCTGATTCAGACACTAATGCCGATCTTGTTGCTGAAACCGTTAAGGAAGGAGGAGATATTGGGGGTGTTGGTGATGACTTCCAGAACTATGAAGGTTGGAACTTTAGTCCAGCTTCAGGTGTTGACACAGTCTGTGTGTTCCCAAAAAACCCTTCAAAATTGGTAGTAGCAGGTGAAGATACCGAGCTACTaattgg...

CDS

Download CDS FASTA

759 bp · LXL04_009631|LXL04_009631|OH1004|CDS

ATGATTCTTCACTTTTTGTTATCATTAACGTGTCCTTCCACAGTTGTCAGGTGTCAATCTGACTCTGATTCAGACACTAATGCCGATCTTGTTGCTGAAACCGTTAAGGAAGGAGGAGATATTGGGGGTGTTGGTGATGACTTCCAGAACTATGAAGGTTGGAACTTTAGTCCAGCTTCAGGTGTTGACACAGTCTGTGTGTTCCCAAAAAACCCTTCAAAATTGGTAGTAGCAGGTGAAGATACCGAGCTACTAATTGG...

Protein

Download Protein FASTA

252 aa · LXL04_009631|LXL04_009631|OH1004|PROTEIN

MILHFLLSLTCPSTVVRCQSDSDSDTNADLVAETVKEGGDIGGVGDDFQNYEGWNFSPASGVDTVCVFPKNPSKLVVAGEDTELLIGLKNEGEQSVKIVEIHASIHLPYHHMLVQNLSSVRFNNASVPALVQATYPYTFSVSKYLQAGTFDLVGMIIYEVDQLPYQNIFYNGTIEVTEAGGVVSVETLFLISLGIALFVLFGLWARGQMQNLSKKTKKVSKVETGTKTVDASMDEWLQGTAYTQLNKSKKKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009631`
TK1151 ID	TkA05G074820
OH-1004 ID	LXL04_009631
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	70.700
Protein coverage (%)	TK1151 97.934 / OH-1004 94.444 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009631

Location Chr02:130005398-130006732 (-)

Description Similar to At2g21160: Translocon-associated protein subunit alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21160`	TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009631 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006613 cotranslational protein targeting to membrane Biological Process

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0031204 post-translational protein targeting to membrane, translocation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21160

ddi:DDB_G0283497

hsa:6745

mmu:107513

pon:100173891

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.886

Rank 1 · LXL04_009631 · OH-1004

Nucleus0.095

Rank 2 · LXL04_009631 · OH-1004

Golgi apparatus0.078

Rank 3 · LXL04_009631 · OH-1004

Cytoplasm0.076

Rank 4 · LXL04_009631 · OH-1004

Cell membrane0.030

Rank 5 · LXL04_009631 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03896.22TRAP_alpha77-232 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009631	`PF03896.22`	TRAP_alpha	77	232	5.3e-10	39.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P45434`	Arabidopsis thaliana	Translocon-associated protein subunit alpha	57.261%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card