LXL04_009569 | RubberDandelionOmics

Gene overview

LXL04_009569

Reference: OH-1004 Chr: Chr02 Coordinates: 129143304-129145739 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

633 bp · LXL04_009569|LXL04_009569|OH1004|cDNA

ATGGCCGCAAGTGCTTCAAGGTTCATCAAGTGTGTGACGGTTGGTGATGGCGCTGTTGGAAAGACTTGTATGCTAATTTGCTATACGAGCAACAAATTCCCAACCGACTATGTACCAACAGTATTTGACAACTTCAGTGCAAATGTTGTAGTTGAAAGCACCACCGTCAATTTAGGGCTTTGGGACACAGCCGGACAAGAAGATTACAACCGGTTAAGACCCTTGAGTTATCGAGGAGCCGATGTATTTGTTCTAGCCTT...

CDS

Download CDS FASTA

633 bp · LXL04_009569|LXL04_009569|OH1004|CDS

ATGGCCGCAAGTGCTTCAAGGTTCATCAAGTGTGTGACGGTTGGTGATGGCGCTGTTGGAAAGACTTGTATGCTAATTTGCTATACGAGCAACAAATTCCCAACCGACTATGTACCAACAGTATTTGACAACTTCAGTGCAAATGTTGTAGTTGAAAGCACCACCGTCAATTTAGGGCTTTGGGACACAGCCGGACAAGAAGATTACAACCGGTTAAGACCCTTGAGTTATCGAGGAGCCGATGTATTTGTTCTAGCCTT...

Protein

Download Protein FASTA

210 aa · LXL04_009569|LXL04_009569|OH1004|PROTEIN

MAASASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVESTTVNLGLWDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHFAPGVPVVLAGTKLDLREDKRYLADHPGLVPVTTAQGEELRKQMGAAYYIECSSKTQQNVKSVFDAAIRVVIKPQQAPKEKKKPRPGCFVNMFCNKKLTCLG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009569`
TK1151 ID	TkA03G449150
OH-1004 ID	LXL04_009569
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009569

Location Chr02:129143304-129145739 (+)

Description Similar to RAC3: Rac-like GTP-binding protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48040`	Acts as a negative regulator of abscisic acid (ABA) responses.	Plasma membrane-associated ROP10 small GTPase is a specific negative regulator of abscisic acid responses in Arabidopsis.2002 · DOI: 10.1105/tpc.005611
`At5g62880`	Involved in local disassembly of cortical microtubules when associated with ICR5 and KIN13A.	CORTICAL MICROTUBULE DISORDERING1 Is Required for Secondary Cell Wall Patterning in Xylem Vessels.2017 · DOI: 10.1105/tpc.17.00663

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0742200`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	No verified direct reference in this release
`Os06g0234200`	Inactive GDP-bound Rho GTPases reside in the cytosol, are found in a complex with Rho GDP-dissociation inhibitors (Rho GDIs), and are released from the GDI protein in order to translocate to membranes upon activation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009569 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0007163 establishment or maintenance of cell polarity Biological Process

GO:0007165 signal transduction Biological Process

GO:0007264 small GTPase-mediated signal transduction Biological Process

GO:0008360 regulation of cell shape Biological Process

GO:0009664 plant-type cell wall organization Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process

GO:0030865 cortical cytoskeleton organization Biological Process

GO:0032956 regulation of actin cytoskeleton organization Biological Process

GO:2001009 regulation of plant-type cell wall cellulose biosynthetic process Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT3G48040

ath:AT5G62880

dosa:Os02g0742200

dosa:Os06g0234200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.649

Rank 1 · LXL04_009569 · OH-1004

Cytoplasm0.344

Rank 2 · LXL04_009569 · OH-1004

Nucleus0.120

Rank 3 · LXL04_009569 · OH-1004

Golgi apparatus0.090

Rank 4 · LXL04_009569 · OH-1004

Endoplasmic reticulum0.056

Rank 5 · LXL04_009569 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00071.29Ras10-179 aa

PF08477.20Roc10-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009569	`PF00071.29`	Ras	10	179	3.6e-48	163.9
LXL04_009569	`PF08477.20`	Roc	10	123	4.7e-22	79.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SU67`	Arabidopsis thaliana	Rac-like GTP-binding protein ARAC8	83.092%	Swiss-Prot	strong database homology
`O82481`	Arabidopsis thaliana	Rac-like GTP-binding protein ARAC10	81.221%	Swiss-Prot	strong database homology
`Q6Z808`	Oryza sativa subsp. japonica	Rac-like GTP-binding protein 3	83.962%	Swiss-Prot	strong database homology
`Q67VP4`	Oryza sativa subsp. japonica	Rac-like GTP-binding protein 4	90.659%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card