LXL04_009548 | RubberDandelionOmics

Gene overview

LXL04_009548

Reference: OH-1004 Chr: Chr02 Coordinates: 128773433-128775944 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1452 bp · LXL04_009548|LXL04_009548|OH1004|cDNA

ATGTCTTTGAACATTCTATCTCCAACAGAAGTCAGAGCCATCTCTTTCTTGGACACCTCCAAATTCAACACCCATCTTCTCAAGCTTCAAGGTGTTGTTTCACTTTTCCAAAATCAATCTCCACCAAATATTAGTGGGTTCTCTTTTAAGAGGAATGCTAGTAAGTTAAAATGTGGAAAGGGGATCCAATGTGCGGCGGCGCCACCTCCTTCGGCATGGCCGGGAACGGCTGCTGTTACGCCGGGGTCTAAGAACTGGAA...

CDS

Download CDS FASTA

1452 bp · LXL04_009548|LXL04_009548|OH1004|CDS

ATGTCTTTGAACATTCTATCTCCAACAGAAGTCAGAGCCATCTCTTTCTTGGACACCTCCAAATTCAACACCCATCTTCTCAAGCTTCAAGGTGTTGTTTCACTTTTCCAAAATCAATCTCCACCAAATATTAGTGGGTTCTCTTTTAAGAGGAATGCTAGTAAGTTAAAATGTGGAAAGGGGATCCAATGTGCGGCGGCGCCACCTCCTTCGGCATGGCCGGGAACGGCTGCTGTTACGCCGGGGTCTAAGAACTGGAA...

Protein

Download Protein FASTA

483 aa · LXL04_009548|LXL04_009548|OH1004|PROTEIN

MSLNILSPTEVRAISFLDTSKFNTHLLKLQGVVSLFQNQSPPNISGFSFKRNASKLKCGKGIQCAAAPPPSAWPGTAAVTPGSKNWNGPKPISIIGSTGSVGTQTLDIVAEHPDKFKVVALAAGSNVTLLADQIKAFKPQLVSIKNESLVNELKEALAGADYMPEIIPGDQGVIEVARHPDCVTVVTGIMGCAGLKPTVAAIEAGKNIALANKETLIAGGPFVLPLAHKHNVKILPADSEHSAIFQCIQGFPEGALRRII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009548`
TK1151 ID	TkA03G447270
OH-1004 ID	LXL04_009548
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009548

Location Chr02:128773433-128775944 (-)

Description Similar to DXR: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g62790`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0106900`	Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADPH-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009548 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0008299 isoprenoid biosynthetic process Biological Process

GO:0019288 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway Biological Process

GO:0051484 isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway involved in terpenoid biosynthetic process Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0030145 manganese ion binding Molecular Function

GO:0030604 1-deoxy-D-xylulose-5-phosphate reductoisomerase activity Molecular Function

GO:0070402 NADPH binding Molecular Function

KEGG gene cross-reference

amr:AM1_0563

ath:AT5G62790

dosa:Os01g0106900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.928

Rank 1 · LXL04_009548 · OH-1004

Mitochondrion0.124

Rank 2 · LXL04_009548 · OH-1004

Cytoplasm0.026

Rank 3 · LXL04_009548 · OH-1004

Nucleus0.015

Rank 4 · LXL04_009548 · OH-1004

Peroxisome0.012

Rank 5 · LXL04_009548 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02670.23DXP_reductoisom92-220 aa

PF08436.18DXP_redisom_C234-317 aa

PF13288.13DXPR_C349-471 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009548	`PF02670.23`	DXP_reductoisom	92	220	6.6e-48	163.3
LXL04_009548	`PF08436.18`	DXP_redisom_C	234	317	2.3e-38	130.9
LXL04_009548	`PF13288.13`	DXPR_C	349	471	1.4e-37	129.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XFS9`	Arabidopsis thaliana	1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic	78.586%	Swiss-Prot	strong database homology
`Q8W250`	Oryza sativa subsp. japonica	1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic	76.605%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card