LXL04_009533 | RubberDandelionOmics

Gene overview

LXL04_009533

Reference: OH-1004 Chr: Chr02 Coordinates: 128326515-128329845 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1041 bp · LXL04_009533|LXL04_009533|OH1004|cDNA

ATGGATGTAGGACACTGCTACTTAGATGGAAACGCGGATGTTGTTGAGTTTTGCCCCCACAATTCCTTCCACCATGTCCTTGCTGCTTCAACTTACACCCTCCAAGAAGGCGATAACCCAACTAGATCCGGAAGCATTTCCCTTTTCAACATCAACTTAAAGAAACTCGATTTATCTTACCGATTAAAAACCGCTGGTATCTTTGACATGAAATGGAACCCTATTATAGGAAGCACCACAACCCGCCCATTGCTAGCCCA...

CDS

Download CDS FASTA

1041 bp · LXL04_009533|LXL04_009533|OH1004|CDS

ATGGATGTAGGACACTGCTACTTAGATGGAAACGCGGATGTTGTTGAGTTTTGCCCCCACAATTCCTTCCACCATGTCCTTGCTGCTTCAACTTACACCCTCCAAGAAGGCGATAACCCAACTAGATCCGGAAGCATTTCCCTTTTCAACATCAACTTAAAGAAACTCGATTTATCTTACCGATTAAAAACCGCTGGTATCTTTGACATGAAATGGAACCCTATTATAGGAAGCACCACAACCCGCCCATTGCTAGCCCA...

Protein

Download Protein FASTA

346 aa · LXL04_009533|LXL04_009533|OH1004|PROTEIN

MDVGHCYLDGNADVVEFCPHNSFHHVLAASTYTLQEGDNPTRSGSISLFNINLKKLDLSYRLKTAGIFDMKWNPIIGSTTTRPLLAQADADGFLKIHHLKSSDNNQLHDLQEVINQKLTSSMCLCLDWDPLATSISVGHSDGSVSLTAFQETKTTILQEWKAHEFEVWATSFDPHQPHLVYTGSDDCKLKGWDLRNYPSSPTFQNSKSHQMGVCCIAKSPHCPYTLYTGSYDEKLRVWDVRSISRPVNEVNLGGGVWRIK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009533`
TK1151 ID	TkA03G445490
OH-1004 ID	LXL04_009533
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 98.844 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009533`
Location	Chr02:128326515-128329845 (+)
Description	Similar to Dph7: Diphthine methyltransferase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009533` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0017183 protein histidyl modification to diphthamide Biological Process GO:0032456 endocytic recycling Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component GO:0005829 cytosol Cellular Component GO:0051723 protein methylesterase activity Molecular Function GO:0061685 diphthine methylesterase activity Molecular Function
KEGG gene cross-reference	ddi:DDB_G0270178 hsa:92715 mmu:67228 sce:YBR246W spo:2539212 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.668

Rank 1 · LXL04_009533 · OH-1004

Nucleus0.510

Rank 2 · LXL04_009533 · OH-1004

Peroxisome0.083

Rank 3 · LXL04_009533 · OH-1004

Mitochondrion0.056

Rank 4 · LXL04_009533 · OH-1004

Lysosome / Vacuole0.047

Rank 5 · LXL04_009533 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24807.2WD40_CDC20-Fz41-183 aa

PF24814.2WD40_Prp1946-253 aa

PF24796.2WDR5581-242 aa

PF25175.2Beta-prop_WDR584-335 aa

PF23609.2Beta-prop_EIPR184-247 aa

PF25173.2Beta-prop_WDR3_1st85-240 aa

PF24807.2WD40_CDC20-Fz108-248 aa

PF23381.2Beta-prop_IFT122_1st111-263 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009533	`PF24807.2`	WD40_CDC20-Fz	41	183	1.3e-19	71.4
LXL04_009533	`PF24814.2`	WD40_Prp19	46	253	3.4e-09	36.9
LXL04_009533	`PF24796.2`	WDR55	81	242	5.2e-13	49.4
LXL04_009533	`PF25175.2`	Beta-prop_WDR5	84	335	6.1e-12	46.1
LXL04_009533	`PF23609.2`	Beta-prop_EIPR1	84	247	3.3e-07	30.7
LXL04_009533	`PF25173.2`	Beta-prop_WDR3_1st	85	240	1.1e-21	78.1
LXL04_009533	`PF24807.2`	WD40_CDC20-Fz	108	248	1.3e-19	71.4
LXL04_009533	`PF23381.2`	Beta-prop_IFT122_1st	111	263	1.5e-19	71.1
LXL04_009533	`PF25172.2`	Beta-prop_WDR3_2nd	116	198	7e-08	32.7
LXL04_009533	`PF25171.2`	Beta-prop_WDR36-Utp21_1st	118	238	1.4e-06	28.7
LXL04_009533	`PF25173.2`	Beta-prop_WDR3_1st	119	260	1.1e-21	78.1
LXL04_009533	`PF25174.2`	Beta-prop_THOC3	122	199	6.6e-18	65.4
LXL04_009533	`PF24796.2`	WDR55	126	249	5.2e-13	49.4
LXL04_009533	`PF25047.1`	Beta-prop_TEP1_2nd	136	247	1.1e-06	28.7
LXL04_009533	`PF00400.39`	WD40	156	193	8.5e-16	58.4
LXL04_009533	`PF25174.2`	Beta-prop_THOC3	182	261	6.6e-18	65.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card