LXL04_009499 | RubberDandelionOmics

Gene overview

LXL04_009499

Reference: OH-1004 Chr: Chr02 Coordinates: 127547461-127553633 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

789 bp · LXL04_009499|LXL04_009499|OH1004|cDNA

ATGGCGGAAGAAATCGCAAATGGCGACACTCTGTTCAATTGCTCAGCGCCTATTCGCGATAAATCCAACAATGAAAAACTTTGGGAGGCCATGATGGCGACAGGTATCTCATCTTCTACAATACTCACCGAAAGCCCTACCCTTAGCCCTTTCTGTTTCTGGTTCCACCAATTTGATTTTCCATTTGAGATTTTAAAGATTTGGCATCTAAAAGTTGGAATGATGAAATTGATTTATTTGTGGATTCATCAAGGGTTGAT...

CDS

Download CDS FASTA

789 bp · LXL04_009499|LXL04_009499|OH1004|CDS

ATGGCGGAAGAAATCGCAAATGGCGACACTCTGTTCAATTGCTCAGCGCCTATTCGCGATAAATCCAACAATGAAAAACTTTGGGAGGCCATGATGGCGACAGGTATCTCATCTTCTACAATACTCACCGAAAGCCCTACCCTTAGCCCTTTCTGTTTCTGGTTCCACCAATTTGATTTTCCATTTGAGATTTTAAAGATTTGGCATCTAAAAGTTGGAATGATGAAATTGATTTATTTGTGGATTCATCAAGGGTTGAT...

Protein

Download Protein FASTA

262 aa · LXL04_009499|LXL04_009499|OH1004|PROTEIN

MAEEIANGDTLFNCSAPIRDKSNNEKLWEAMMATGISSSTILTESPTLSPFCFWFHQFDFPFEILKIWHLKVGMMKLIYLWIHQGLILLPFSRVEEGASKIVFKVQTYCKKVMESVIGGIMELLNLRIHPFVSKSRTTISFNGNQDWYGKQGEMVKKVVSSMPVHFQVSYKKHMTTHDSSLIICSSEVFYVPRRLVNDFKDLVNLVGNLDIHQKVAIPMFFLAMDSTENFDYVKKTTMNSNHVSSQTPSNLCFFLTAAAP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009499`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009499

Location Chr02:127547461-127553633 (-)

Description Similar to STL2: Probable glycosyltransferase STELLO2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57420`	Probable glycosyltransferase regulating the assembly and trafficking of cellulose synthase complexes.	No verified direct reference in this release
`At2g41770`	Probable glycosyltransferase regulating the assembly and trafficking of cellulose synthase complexes.	No verified direct reference in this release
`At4g04955`	Catalyzes the conversion of allantoin (5-ureidohydantoin) to allantoate by hydrolytic cleavage of the five-member hydantoin ring.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009499 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000256 allantoin catabolic process Biological Process

GO:0006145 purine nucleobase catabolic process Biological Process

GO:0006995 cellular response to nitrogen starvation Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0010136 ureide catabolic process Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:2001009 regulation of plant-type cell wall cellulose biosynthetic process Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

KEGG gene cross-reference

ath:AT2G41770

ath:AT3G57420

ath:AT4G04955

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.421

Rank 1 · LXL04_009499 · OH-1004

Cytoplasm0.366

Rank 2 · LXL04_009499 · OH-1004

Mitochondrion0.147

Rank 3 · LXL04_009499 · OH-1004

Cell membrane0.091

Rank 4 · LXL04_009499 · OH-1004

Endoplasmic reticulum0.074

Rank 5 · LXL04_009499 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCN0`	Arabidopsis thaliana	Probable glycosyltransferase STELLO2	63.107%	Swiss-Prot	weak database homology
`O22943`	Arabidopsis thaliana	Probable glycosyltransferase STELLO1	51.938%	Swiss-Prot	weak database homology
`Q94AP0`	Arabidopsis thaliana	Allantoinase	65.714%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card