LXL04_009488 | RubberDandelionOmics

Gene overview

LXL04_009488

Reference: OH-1004 Chr: Chr02 Coordinates: 127289394-127290120 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_009488|LXL04_009488|OH1004|cDNA

ATGGAGGCTCATCCTTCTTtgattcttcttcttcttcttctttcttgcTTTGCAGCTTCATCTTATGCTCATAATGTCCGCTTCTCCAATCTCAACCACTCCCTCATTGTTACCGTTTCAACTACACCAGGCCAAGTGTTGAGGGCAGGGGAAGATCAAGTGACAATCACATGGTTATACAATACGAGCTACACCGGGTCAGACGCCAACTACACCACCGTGGAAGCCTGGCTATGCTACGCGCCGGTGAGCCAGACCGG...

CDS

Download CDS FASTA

591 bp · LXL04_009488|LXL04_009488|OH1004|CDS

ATGGAGGCTCATCCTTCTTTGATTCTTCTTCTTCTTCTTCTTTCTTGCTTTGCAGCTTCATCTTATGCTCATAATGTCCGCTTCTCCAATCTCAACCACTCCCTCATTGTTACCGTTTCAACTACACCAGGCCAAGTGTTGAGGGCAGGGGAAGATCAAGTGACAATCACATGGTTATACAATACGAGCTACACCGGGTCAGACGCCAACTACACCACCGTGGAAGCCTGGCTATGCTACGCGCCGGTGAGCCAGACCGG...

Protein

Download Protein FASTA

196 aa · LXL04_009488|LXL04_009488|OH1004|PROTEIN

MEAHPSLILLLLLLSCFAASSYAHNVRFSNLNHSLIVTVSTTPGQVLRAGEDQVTITWLYNTSYTGSDANYTTVEAWLCYAPVSQTGRDDRKTDDSLDNDKTCPFEITDGPYRRSNNSFVWTVPRDIPTATYFVRVYALRSKDHETAYGQSTDALKTTSLFQVNGTVSNQEVSAAVIGGSFGYGYAWLLMLFLAYI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009488`
TK1151 ID	TkA03G441850
OH-1004 ID	LXL04_009488
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009488

Location Chr02:127289394-127290120 (-)

Description Similar to NRT3.2: High-affinity nitrate transporter 3.2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24715`	Acts as a dual component transporter with NTR2.1.	High-affinity nitrate transport in roots of Arabidopsis depends on expression of the NAR2-like gene AtNRT3.1.2006 · DOI: 10.1104/pp.105.074385
`At5g50200`	Acts as a dual component transporter with NTR2.1.	High-affinity nitrate transport in roots of Arabidopsis depends on expression of the NAR2-like gene AtNRT3.1.2006 · DOI: 10.1104/pp.105.074385 Characterization of a two-component high-affinity nitrate uptake system in Arabidopsis. Physiology and protein-protein interaction.2006 · DOI: 10.1104/pp.106.085209 Regulation of root nitrate uptake at the NRT2.1 protein level in Arabidopsis thaliana.2007 · DOI: 10.1074/jbc.m700901200 Nitrate signaling and the two component high affinity uptake system in Arabidopsis.2007 · DOI: 10.4161/psb.2.4.3870

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0595900`	Acts as a dual component transporter with NTR2.1, NRT2.2 and NRT2.3.	Spatial expression and regulation of rice high-affinity nitrate transporters by nitrogen and carbon status.2011 · DOI: 10.1093/jxb/erq403 Rice OsNAR2.1 interacts with OsNRT2.1, OsNRT2.2 and OsNRT2.3a nitrate transporters to provide uptake over high and low concentration ranges.2011 · DOI: 10.1111/j.1365-3040.2011.02335.x
`Os04g0480200`	Involved in nitrate transport.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009488 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009611 response to wounding Biological Process

GO:0010167 response to nitrate Biological Process

GO:0015706 nitrate transmembrane transport Biological Process

GO:0042128 nitrate assimilation Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0015112 nitrate transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT4G24715

ath:AT5G50200

dosa:Os02g0595900

dosa:Os04g0480200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.421

Rank 1 · LXL04_009488 · OH-1004

Lysosome / Vacuole0.195

Rank 2 · LXL04_009488 · OH-1004

Cytoplasm0.190

Rank 3 · LXL04_009488 · OH-1004

Extracellular0.185

Rank 4 · LXL04_009488 · OH-1004

Endoplasmic reticulum0.127

Rank 5 · LXL04_009488 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16974.12NAR228-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009488	`PF16974.12`	NAR2	28	165	8e-49	165.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SB67`	Arabidopsis thaliana	High-affinity nitrate transporter 3.2	43.195%	Swiss-Prot	moderate database homology
`Q9FGS5`	Arabidopsis thaliana	High-affinity nitrate transporter 3.1	39.899%	Swiss-Prot	moderate database homology
`Q6ZI50`	Oryza sativa subsp. japonica	High-affinity nitrate transporter-activating protein 2.1	42.105%	Swiss-Prot	moderate database homology
`Q7XK12`	Oryza sativa subsp. japonica	Probable high-affinity nitrate transporter-activating protein 2.2	39.865%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card