LXL04_009413 | RubberDandelionOmics

Gene overview

LXL04_009413

Reference: OH-1004 Chr: Chr02 Coordinates: 125553054-125554517 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

738 bp · LXL04_009413|LXL04_009413|OH1004|cDNA

ATGGCAACTTCAGCGGCCGCGAATTTGGAAGATGTTGCGTCGGTAGATCTAATGACGGAGCTTCTTCGTCGCATGAAATGCTCCACCAAACCTGACAAACGCCTCATTCTCGTCGGTCCACCTGGATCAGGAAAAGGTACCCAGTCCCCAATTATCAAGGACGAGTACTGTTTATGTCACTTAGCTACTGGCGATATGCTAAGAGCTGCTGTTGCTGCAAAAACTCCTCTTGGTGTCAAAGCCAAGGAAGCCATGGAAAA...

CDS

Download CDS FASTA

738 bp · LXL04_009413|LXL04_009413|OH1004|CDS

ATGGCAACTTCAGCGGCCGCGAATTTGGAAGATGTTGCGTCGGTAGATCTAATGACGGAGCTTCTTCGTCGCATGAAATGCTCCACCAAACCTGACAAACGCCTCATTCTCGTCGGTCCACCTGGATCAGGAAAAGGTACCCAGTCCCCAATTATCAAGGACGAGTACTGTTTATGTCACTTAGCTACTGGCGATATGCTAAGAGCTGCTGTTGCTGCAAAAACTCCTCTTGGTGTCAAAGCCAAGGAAGCCATGGAAAA...

Protein

Download Protein FASTA

245 aa · LXL04_009413|LXL04_009413|OH1004|PROTEIN

MATSAAANLEDVASVDLMTELLRRMKCSTKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGVKAKEAMEKGLLVSDDLVVGIINEALEKPSCQKGFILDGFPRTVVQAEKLDEMLKRRGVKVDKVLNFAIDDAILEERITGRWIHPSSGRSYHSKFAPPKVPGIDDVTGEPLVQRKDDTAAVLKSRLEAFHKQTEPVIDYYSKKRIVANLHADKPPQEVTAEVQKVLS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009413`
TK1151 ID	TkA03G435180
OH-1004 ID	LXL04_009413
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009413

Location Chr02:125553054-125554517 (+)

Description Similar to ADK-B: Adenylate kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63400`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`At5g50370`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: Q08480`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release
`Os12g0236400`	Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009413 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006163 purine nucleotide metabolic process Biological Process

GO:0006166 purine ribonucleoside salvage Biological Process

GO:0006172 ADP biosynthetic process Biological Process

GO:0046033 AMP metabolic process Biological Process

GO:0046034 ATP metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005758 mitochondrial intermembrane space Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009536 plastid Cellular Component

GO:0004017 AMP kinase activity Molecular Function

KEGG gene cross-reference

ath:AT5G50370

ath:AT5G63400

ddi:DDB_G0283805

dosa:Os11g0312400

dosa:Os12g0236400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.651

Rank 1 · LXL04_009413 · OH-1004

Cytoplasm0.260

Rank 2 · LXL04_009413 · OH-1004

Plastid0.103

Rank 3 · LXL04_009413 · OH-1004

Nucleus0.096

Rank 4 · LXL04_009413 · OH-1004

Peroxisome0.061

Rank 5 · LXL04_009413 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00406.30ADK37-222 aa

PF13207.13AAA_1738-158 aa

PF05191.21ADK_lid159-194 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009413	`PF00406.30`	ADK	37	222	7.2e-59	199.0
LXL04_009413	`PF13207.13`	AAA_17	38	158	1.3e-24	87.7
LXL04_009413	`PF05191.21`	ADK_lid	159	194	1.8e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82514`	Arabidopsis thaliana	Adenylate kinase 4	81.707%	Swiss-Prot	strong database homology
`Q9FK35`	Arabidopsis thaliana	Adenylate kinase 3	78.481%	Swiss-Prot	strong database homology
`Q08480`	Oryza sativa subsp. japonica	Adenylate kinase 4	90.083%	Swiss-Prot	strong database homology
`Q08479`	Oryza sativa subsp. japonica	Adenylate kinase 3	86.250%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card