LXL04_009406 | RubberDandelionOmics

Gene overview

LXL04_009406

Reference: OH-1004 Chr: Chr02 Coordinates: 125458413-125460192 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

990 bp · LXL04_009406|LXL04_009406|OH1004|cDNA

ATGGGCGGTAAGTTCAATTCAATCTCCCTTACATGCTCTTCATATGTTGCTTTACAAAATAGCAATGAATCATCCCAATTTTTTTCCCCCTTTTTGGATGAATTTCCTGATGCAGTGAGTGAAAAAGTAGTAGCAGTGGACTGTAATTCGAGTTTATGGCTAGCACCAAATCCAAGCAAGAGATGGGGTGAACTGTTCTTCCTTCTATACACACCATTTTGGCTCACCCTATGTCTCGGAATCGTCGTCCCTTACAAGCT...

CDS

Download CDS FASTA

990 bp · LXL04_009406|LXL04_009406|OH1004|CDS

ATGGGCGGTAAGTTCAATTCAATCTCCCTTACATGCTCTTCATATGTTGCTTTACAAAATAGCAATGAATCATCCCAATTTTTTTCCCCCTTTTTGGATGAATTTCCTGATGCAGTGAGTGAAAAAGTAGTAGCAGTGGACTGTAATTCGAGTTTATGGCTAGCACCAAATCCAAGCAAGAGATGGGGTGAACTGTTCTTCCTTCTATACACACCATTTTGGCTCACCCTATGTCTCGGAATCGTCGTCCCTTACAAGCT...

Protein

Download Protein FASTA

329 aa · LXL04_009406|LXL04_009406|OH1004|PROTEIN

MGGKFNSISLTCSSYVALQNSNESSQFFSPFLDEFPDAVSEKVVAVDCNSSLWLAPNPSKRWGELFFLLYTPFWLTLCLGIVVPYKLYEDFKELEYLLLGLISVLPAFLIPIFVVGKADRSLKWKDRYWVKASLWIIIFSYVGNYFWTHYFFTVLGASYTFPSWKMNNVPHTTFLLTNVCFLFYHVTSNLTLRRLQHSVAHLPVRTQWIVKSAWILALSYFIAYLETVAISNFPYYTFVDRSSMYKVGSLFYAIYFLVSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009406`
TK1151 ID	TkA03G434410
OH-1004 ID	LXL04_009406
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.098 / OH-1004 88.450 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009406

Location Chr02:125458413-125460192 (-)

Description Similar to CPI1: Cycloeucalenol cycloisomerase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g50375`	Converts pentacyclic cyclopropyl sterols to tetracyclic sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009406 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0006907 pinocytosis Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0016126 sterol biosynthetic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0016020 membrane Cellular Component

GO:0047793 cycloeucalenol cycloisomerase activity Molecular Function

KEGG gene cross-reference

ath:AT5G50375

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.558

Rank 1 · LXL04_009406 · OH-1004

Golgi apparatus0.202

Rank 2 · LXL04_009406 · OH-1004

Nucleus0.105

Rank 3 · LXL04_009406 · OH-1004

Cell membrane0.091

Rank 4 · LXL04_009406 · OH-1004

Cytoplasm0.089

Rank 5 · LXL04_009406 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M643`	Arabidopsis thaliana	Cycloeucalenol cycloisomerase	81.181%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card