LXL04_009354 | RubberDandelionOmics

Gene overview

LXL04_009354

Reference: OH-1004 Chr: Chr02 Coordinates: 123885040-123889708 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2406 bp · LXL04_009354|LXL04_009354|OH1004|cDNA

ATGTCCTCGAGAAGGCGTCTGAGAATAGTTTGTTCATCTGACGAAGAAGATGAGCACGACGAAATACAAGAAGTGCAACCTCCTCCTCCACAACACGATGATATCGAATGCGAAACCCTCAATTTTCAAGATGTAACCCTAAGTTCCATTAACACTAACCCTACCAATCCCTCTGCTTCCATTCAAGTGGATATATCCGACGATGACTTCATCGACGCAGCCGAGGACCTCTTCCATTCTCCTCAATCTCCACCTCCGCC...

CDS

Download CDS FASTA

2406 bp · LXL04_009354|LXL04_009354|OH1004|CDS

ATGTCCTCGAGAAGGCGTCTGAGAATAGTTTGTTCATCTGACGAAGAAGATGAGCACGACGAAATACAAGAAGTGCAACCTCCTCCTCCACAACACGATGATATCGAATGCGAAACCCTCAATTTTCAAGATGTAACCCTAAGTTCCATTAACACTAACCCTACCAATCCCTCTGCTTCCATTCAAGTGGATATATCCGACGATGACTTCATCGACGCAGCCGAGGACCTCTTCCATTCTCCTCAATCTCCACCTCCGCC...

Protein

Download Protein FASTA

801 aa · LXL04_009354|LXL04_009354|OH1004|PROTEIN

MSSRRRLRIVCSSDEEDEHDEIQEVQPPPPQHDDIECETLNFQDVTLSSINTNPTNPSASIQVDISDDDFIDAAEDLFHSPQSPPPPPPLNQTVYSLDYSIASSVGSNEPSGSPISKILEDLGLRLRGEWLDACLLGLQTAIPGFSSFDATKKAKLCFEKFLHSDMNHCGAGFLPDNVHQMHLVDLPGPFVLQVDEIVNISQPLRERYKKANCGLKRCLKLSMTDGVQRVFGMEYQPIKDLEALAPAGLKVAISNVNVRH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009354`
TK1151 ID	TkA03G428510
OH-1004 ID	LXL04_009354
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	83.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009354

Location Chr02:123885040-123889708 (+)

Description Similar to RMI1: RecQ-mediated genome instability protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63540`	Essential component of the RMI complex, a complex that plays an important role in the resolution step of homologous recombination, in a process called Holliday Junction dissolution, to limit DNA crossover formation in cells.	The Arabidopsis BLAP75/Rmi1 homologue plays crucial roles in meiotic double-strand break repair.2008 · DOI: 10.1371/journal.pgen.1000309 Topoisomerase 3alpha and RMI1 suppress somatic crossovers and are essential for resolution of meiotic recombination intermediates in Arabidopsis thaliana.2008 · DOI: 10.1371/journal.pgen.1000285 Different functions for the domains of the Arabidopsis thaliana RMI1 protein in DNA cross-link repair, somatic and meiotic recombination.2013 · DOI: 10.1093/nar/gkt730

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0391000`	Essential component of the RMI complex, a complex that plays an important role in the resolution step of homologous recombination, in a process called Holliday Junction dissolution, to limit DNA crossover formation in cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009354 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006260 DNA replication Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0005634 nucleus Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0031422 RecQ family helicase-topoisomerase III complex Cellular Component

GO:0000166 nucleotide binding Molecular Function

KEGG gene cross-reference

ath:AT5G63540

dosa:Os04g0391000

gga:431669

osa:4335680

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.823

Rank 1 · LXL04_009354 · OH-1004

Cytoplasm0.243

Rank 2 · LXL04_009354 · OH-1004

Cell membrane0.037

Rank 3 · LXL04_009354 · OH-1004

Endoplasmic reticulum0.025

Rank 4 · LXL04_009354 · OH-1004

Lysosome / Vacuole0.019

Rank 5 · LXL04_009354 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08585.19RMI1_N_C174-285 aa

PF16099.12RMI1_C643-786 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009354	`PF08585.19`	RMI1_N_C	174	285	2.8e-26	92.7
LXL04_009354	`PF16099.12`	RMI1_C	643	786	1.1e-39	136.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5XUX6`	Arabidopsis thaliana	RecQ-mediated genome instability protein 1	53.943%	Swiss-Prot	weak database homology
`Q7XRV0`	Oryza sativa subsp. japonica	RecQ-mediated genome instability protein 1	60.386%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card