LXL04_009299 | RubberDandelionOmics

Gene overview

LXL04_009299

Reference: OH-1004 Chr: Chr02 Coordinates: 122217208-122221152 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2842 bp · LXL04_009299|LXL04_009299|OH1004|cDNA

TTGGACGGTTAAAAAACGATTGCAACCGTCTCCGGCCTTCTTGTATCTCTCTCCGGAGATCCCGAAAAAGAGGGAAGCAATTGAAAAAAAGACATAAAAAGGTCGCAAACAGCTTTATCCGAATCGAATGATGGCGGCAAATGAAACCAAAGATGACCTTTACGCTCTCTCTCTTCAGAAAGAAGAAGATGACAAGTACAAGGAGTATGATTTCGGATCTGACGACAGTGATCCCCCTCTTCCCCTAACCGTCGCATCTC...

CDS

Download CDS FASTA

2715 bp · LXL04_009299|LXL04_009299|OH1004|CDS

ATGATGGCGGCAAATGAAACCAAAGATGACCTTTACGCTCTCTCTCTTCAGAAAGAAGAAGATGACAAGTACAAGGAGTATGATTTCGGATCTGACGACAGTGATCCCCCTCTTCCCCTAACCGTCGCATCTCGTGTACTGTACATGTTAGGTGATATTGCAGCAGGCCCTGCTTTTCGATTTACTCAGTGGTTGGAATTAGTACGGAAGCGTAGTGGCAAGTATAAGTCCTCTGGCTTCCCTCATCGCCCTCAAAGACT...

Protein

Download Protein FASTA

904 aa · LXL04_009299|LXL04_009299|OH1004|PROTEIN

MMAANETKDDLYALSLQKEEDDKYKEYDFGSDDSDPPLPLTVASRVLYMLGDIAAGPAFRFTQWLELVRKRSGKYKSSGFPHRPQRLDNLLLSAGDLSLESKNSTVFEQVAEISLWERLGKAAMLNIDASSFSWDMLSSLHHTEHSSSNEHSEDEMNKALEVTVNSGGVVFFALFNNNESREFLPKEAAAVIKIASSRMATQSERLGYEFAKWLGVRTPQARVIHNCSTEWLKIKEAAEKAKEAAVSDGDEVGEVTCSEL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009299`
TK1151 ID	TkA03G416590
OH-1004 ID	LXL04_009299
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009299

Location Chr02:122217208-122221152 (-)

Description Similar to PHS1: Dual specificity protein phosphatase PHS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23720`	Probable dual specificity phosphatase that binds and dephosphorylates MPK18, modulating the organization and dynamics of cortical microtubules.	No verified direct reference in this release
`At3g23610`	Has a dual specificity toward Ser/Thr and Tyr-containing proteins.	Identification of a dual-specificity protein phosphatase that inactivates a MAP kinase from Arabidopsis.1998 · DOI: 10.1046/j.1365-313x.1998.00327.x
`At3g06110`	Has a dual specificity toward Ser/Thr and Tyr-containing proteins.	Arabidopsis MAPK phosphatase 2 (MKP2) positively regulates oxidative stress tolerance and inactivates the MPK3 and MPK6 MAPKs.2007 · DOI: 10.1074/jbc.m701888200 MAPK phosphatase MKP2 mediates disease responses in Arabidopsis and functionally interacts with MPK3 and MPK6.2010 · DOI: 10.1111/j.1365-313x.2010.04297.x Regulation of MAPK signaling and cell death by MAPK phosphatase MKP2.2010 · DOI: 10.4161/psb.5.11.13645

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009299 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010193 response to ozone Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0034599 cellular response to oxidative stress Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0043622 cortical microtubule organization Biological Process

KEGG gene cross-reference

ath:AT3G06110

ath:AT3G23610

ath:AT5G23720

ddi:DDB_G0278445

hsa:128854680

hsa:51207

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.422

Rank 1 · LXL04_009299 · OH-1004

Nucleus0.325

Rank 2 · LXL04_009299 · OH-1004

Cell membrane0.248

Rank 3 · LXL04_009299 · OH-1004

Golgi apparatus0.107

Rank 4 · LXL04_009299 · OH-1004

Endoplasmic reticulum0.102

Rank 5 · LXL04_009299 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09192.17Act-Frag_cataly112-368 aa

PF00782.26DSPc696-828 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009299	`PF09192.17`	Act-Frag_cataly	112	368	2e-46	159.4
LXL04_009299	`PF00782.26`	DSPc	696	828	3.1e-26	92.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q75QN6`	Arabidopsis thaliana	Dual specificity protein phosphatase PHS1	63.082%	Swiss-Prot	strong database homology
`Q9ZR37`	Arabidopsis thaliana	Dual specificity protein phosphatase 1	32.121%	Swiss-Prot	weak database homology
`Q9M8K7`	Arabidopsis thaliana	Dual specificity protein phosphatase 1B	33.803%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card