LXL04_009285 | RubberDandelionOmics

Gene overview

LXL04_009285

Reference: OH-1004 Chr: Chr02 Coordinates: 122019547-122020413 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

723 bp · LXL04_009285|LXL04_009285|OH1004|cDNA

ATGCATCATAGGAGGCATGGAAAGAGGACCCTTGTGGCCGACGAGAAAGAAGATGACGACATATTTCCAGTCTACTCACATCAGTCACAAGAAGATATGACTGCCATTGTCTCCGCCCTTTCTCAAGTCATCGGAAGCGACGACACCGCTACTCATCCTCCTATCTCCTCCTACTCTGCTTCTTCCGCCGCtccaaatcaaccaccacccacCATTCAACAATCACCAGAAGGGAATCAGAGAAGAAGACACTACAGAGG...

CDS

Download CDS FASTA

723 bp · LXL04_009285|LXL04_009285|OH1004|CDS

ATGCATCATAGGAGGCATGGAAAGAGGACCCTTGTGGCCGACGAGAAAGAAGATGACGACATATTTCCAGTCTACTCACATCAGTCACAAGAAGATATGACTGCCATTGTCTCCGCCCTTTCTCAAGTCATCGGAAGCGACGACACCGCTACTCATCCTCCTATCTCCTCCTACTCTGCTTCTTCCGCCGCTCCAAATCAACCACCACCCACCATTCAACAATCACCAGAAGGGAATCAGAGAAGAAGACACTACAGAGG...

Protein

Download Protein FASTA

240 aa · LXL04_009285|LXL04_009285|OH1004|PROTEIN

MHHRRHGKRTLVADEKEDDDIFPVYSHQSQEDMTAIVSALSQVIGSDDTATHPPISSYSASSAAPNQPPPTIQQSPEGNQRRRHYRGVRQRPWGKWAAEIRDPQKAARVWLGTFETAEAAAIAYDEAALRFKGNKAKLNFPERVQPGRTELGYLTTRTPQSYNYNDQPQLPVPPPYHAATMPPTNYDHLHNYPQFYLEANETGYNPYILQSPSSSATNLHGNSSGFGSTQYWQDFDPRNY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009285`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009285

Location Chr02:122019547-122020413 (+)

Description Similar to ERF114: Ethylene-responsive transcription factor ERF114

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g61890`	Transcriptional regulator of cell proliferation and axillary bud outgrowth.	EBE, an AP2/ERF transcription factor highly expressed in proliferating cells, affects shoot architecture in Arabidopsis.2013 · DOI: 10.1104/pp.113.214049
`At5g07310`	Acts as a transcriptional activator of the phytosulfokine PSK5 peptide hormone.	No verified direct reference in this release
`At5g13330`	Transcriptional activator involved in the regulation of plant development and tolerance to abiotic stresses.	Functional characterization of four APETALA2-family genes (RAP2.6, RAP2.6L, DREB19 and DREB26) in Arabidopsis.2011 · DOI: 10.1007/s11103-010-9711-7 RAP2.6L overexpression delays waterlogging induced premature senescence by increasing stomatal closure more than antioxidant enzyme activity.2012 · DOI: 10.1007/s11103-012-9936-8
`At2g33710`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At2g47520`	Transcriptional activator that binds specifically to the cis- acting element GCC box 5'-AGCCGCC-3', or to the CRT/DRE element 5'- [AG]CCGAC-3'.	HRE1 and HRE2, two hypoxia-inducible ethylene response factors, affect anaerobic responses in Arabidopsis thaliana.2010 · DOI: 10.1111/j.1365-313x.2010.04149.x The hypoxia responsive transcription factor genes ERF71/HRE2 and ERF73/HRE1 of Arabidopsis are differentially regulated by ethylene.2011 · DOI: 10.1111/j.1399-3054.2011.01486.x AtERF71/HRE2 transcription factor mediates osmotic stress response as well as hypoxia response in Arabidopsis.2011 · DOI: 10.1016/j.bbrc.2011.09.039 Homeostatic response to hypoxia is regulated by the N-end rule pathway in plants.2011 · DOI: 10.1038/nature10534 Arabidopsis AtERF71/HRE2 functions as transcriptional activator via cis-acting GCC box or DRE/CRT element and is involved in root development through regulation of root cell expansion.2015 · DOI: 10.1007/s00299-014-1701-9 Hypoxia and the group VII ethylene response transcription factor HRE2 promote adventitious root elongation in Arabidopsis.2019 · DOI: 10.1111/plb.12873 The possible roles of AtERF71 in the defense response against the Fusarium graminearum .2018 · DOI: 10.5511/plantbiotechnology.18.0501b

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009285 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0009611 response to wounding Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009751 response to salicylic acid Biological Process

GO:0009753 response to jasmonic acid Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

KEGG gene cross-reference

ath:AT2G33710

ath:AT2G47520

ath:AT5G07310

ath:AT5G13330

ath:AT5G61890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.931

Rank 1 · LXL04_009285 · OH-1004

Cytoplasm0.130

Rank 2 · LXL04_009285 · OH-1004

Endoplasmic reticulum0.042

Rank 3 · LXL04_009285 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_009285 · OH-1004

Plastid0.020

Rank 5 · LXL04_009285 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP284-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009285	`PF00847.27`	AP2	84	133	6.2e-14	52.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FH54`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF114	60.959%	Swiss-Prot	moderate database homology
`Q9LY29`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF115	56.647%	Swiss-Prot	moderate database homology
`Q9LYU3`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF113	65.766%	Swiss-Prot	weak database homology
`P93007`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF112	48.993%	Swiss-Prot	moderate database homology
`O22259`	Arabidopsis thaliana	Ethylene-responsive transcription factor ERF071	55.172%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card