LXL04_009230 | RubberDandelionOmics

Gene overview

LXL04_009230

Reference: OH-1004 Chr: Chr02 Coordinates: 121024662-121025912 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1251 bp · LXL04_009230|LXL04_009230|OH1004|cDNA

ATGGATTCGGTTTTCAAGAATGGGAATGAGAAAAAGAGGAGTTTGATCAGTTCCGAAAGTTGGGTGGTGAAGGATGAGAGAAAGAGAAGGAAGCAAGAACATGATGTGCTTGAACAGAGCAAGTATGGCGATGGAATGGTCTGGTTTAGAGGTTGTTTGATCGGTAAAGGGTGTTTTGGGTCTGTTTATGTTGCGAATTTGAAGAAACCCAAATCGAGATACAGCTCTTTCCCACCAATTATGGCTGTCAAATCGGCTGA...

CDS

Download CDS FASTA

1251 bp · LXL04_009230|LXL04_009230|OH1004|CDS

ATGGATTCGGTTTTCAAGAATGGGAATGAGAAAAAGAGGAGTTTGATCAGTTCCGAAAGTTGGGTGGTGAAGGATGAGAGAAAGAGAAGGAAGCAAGAACATGATGTGCTTGAACAGAGCAAGTATGGCGATGGAATGGTCTGGTTTAGAGGTTGTTTGATCGGTAAAGGGTGTTTTGGGTCTGTTTATGTTGCGAATTTGAAGAAACCCAAATCGAGATACAGCTCTTTCCCACCAATTATGGCTGTCAAATCGGCTGA...

Protein

Download Protein FASTA

416 aa · LXL04_009230|LXL04_009230|OH1004|PROTEIN

MDSVFKNGNEKKRSLISSESWVVKDERKRRKQEHDVLEQSKYGDGMVWFRGCLIGKGCFGSVYVANLKKPKSRYSSFPPIMAVKSAEVSVSSSIQKEKEVLNNLRGCRNVIRCFGEEITTGENGHMVYNLLLEYGSGGTLADLINKSGRNGLPESDVKRHTRSILHGLRHIHNNGYVHCDLKPENILLVGTSSNRRFTAKIGDLGLAKRAKQSKKNKVVLFQRGTPMYFSPEVLIDGVQEAPSDIWAFGCIVSEMFTGKP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009230`
TK1151 ID	TkA03G411860
OH-1004 ID	LXL04_009230
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 89.183 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009230

Location Chr02:121024662-121025912 (+)

Description Similar to MAPKKK20: Mitogen-activated protein kinase kinase kinase 20

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50310`	Mitogen-activated protein kinase kinase (MAPKK) that phosphorylates both MKK3 and MPK18 and regulate two separate signaling pathways involved in root microtubule functions.	Arabidopsis MKKK20 is involved in osmotic stress response via regulation of MPK6 activity.2012 · DOI: 10.1007/s00299-011-1157-0 AIK1, A Mitogen-Activated Protein Kinase, Modulates Abscisic Acid Responses through the MKK5-MPK6 Kinase Cascade.2017 · DOI: 10.1104/pp.16.01386 The Arabidopsis Mitogen-Activated Protein Kinase Kinase Kinase 20 (MKKK20) Acts Upstream of MKK3 and MPK18 in Two Separate Signaling Pathways Involved in Root Microtubule Functions.2017 · DOI: 10.3389/fpls.2017.01352
`At2g32510`	Component of the abscisic acid (ABA) signaling pathway that may act as ABA signal transducer in the context of abiotic stresses.	No verified direct reference in this release
`At1g05100`	Component of the abscisic acid (ABA) signaling pathway that acts as ABA signal transducer in the context of abiotic stresses.	An abscisic acid inducible Arabidopsis MAPKKK, MAPKKK18 regulates leaf senescence via its kinase activity.2015 · DOI: 10.1007/s11103-015-0295-0 Arabidopsis ABA-Activated Kinase MAPKKK18 is Regulated by Protein Phosphatase 2C ABI1 and the Ubiquitin-Proteasome Pathway.2015 · DOI: 10.1093/pcp/pcv146
`At1g09000`	May be involved in an oxidative stress-mediated signaling cascade that phosphorylates downstream MAP kinases MPK3 and MPK6.	Functional analysis of oxidative stress-activated mitogen-activated protein kinase cascade in plants.2000 · DOI: 10.1073/pnas.97.6.2940 An Arabidopsis mitogen-activated protein kinase kinase kinase gene family encodes essential positive regulators of cytokinesis.2002 · DOI: 10.1105/tpc.001164
`At3g06030`	Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule- associated proteins such as MAP65-1.	Arabidopsis homologs of nucleus- and phragmoplast-localized kinase 2 and 3 and mitogen-activated protein kinase 4 are essential for microtubule organization.2010 · DOI: 10.1105/tpc.109.071746

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009230 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000302 response to reactive oxygen species Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0007165 signal transduction Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0010029 regulation of seed germination Biological Process

KEGG gene cross-reference

ath:AT1G05100

ath:AT1G09000

ath:AT2G32510

ath:AT3G06030

ath:AT3G50310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.910

Rank 1 · LXL04_009230 · OH-1004

Cytoplasm0.143

Rank 2 · LXL04_009230 · OH-1004

Cell membrane0.042

Rank 3 · LXL04_009230 · OH-1004

Endoplasmic reticulum0.027

Rank 4 · LXL04_009230 · OH-1004

Plastid0.021

Rank 5 · LXL04_009230 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase53-311 aa

PF07714.24PK_Tyr_Ser-Thr53-302 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009230	`PF00069.32`	Pkinase	53	311	2.7e-45	155.6
LXL04_009230	`PF07714.24`	PK_Tyr_Ser-Thr	53	302	5.1e-25	89.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SND6`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 20	44.828%	Swiss-Prot	moderate database homology
`O80888`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 17	38.489%	Swiss-Prot	moderate database homology
`Q9ZVP5`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 18	38.078%	Swiss-Prot	moderate database homology
`O22040`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase ANP1	29.144%	Swiss-Prot	weak database homology
`O22042`	Arabidopsis thaliana	Mitogen-activated protein kinase kinase kinase 3	30.769%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card