LXL04_009216 | RubberDandelionOmics

Gene overview

LXL04_009216

Reference: OH-1004 Chr: Chr02 Coordinates: 120647897-120649225 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1329 bp · LXL04_009216|LXL04_009216|OH1004|cDNA

ATGGAAGATTTTGTTGATACTTGTCACGGCGGTGGCGATCGGGGTGGCCGGAATATTATTTTTGGGAAGTACGAGATGGGTCGGTTGTTGGGACAAGGGACGTTTGGAAAAGTGTACTATGCTAAAGACCTCGTAAGTTCCGAAAGTGTGGCGATTAAAGTGATAAAGAAAGATCAAGTTCGAAAAGAAGGTTTGATGGATCAGATCACTCGTGAAATCTCCATCATGCGGCTTGTTCGACACCCAAATGTCGTTGAATT...

CDS

Download CDS FASTA

1329 bp · LXL04_009216|LXL04_009216|OH1004|CDS

ATGGAAGATTTTGTTGATACTTGTCACGGCGGTGGCGATCGGGGTGGCCGGAATATTATTTTTGGGAAGTACGAGATGGGTCGGTTGTTGGGACAAGGGACGTTTGGAAAAGTGTACTATGCTAAAGACCTCGTAAGTTCCGAAAGTGTGGCGATTAAAGTGATAAAGAAAGATCAAGTTCGAAAAGAAGGTTTGATGGATCAGATCACTCGTGAAATCTCCATCATGCGGCTTGTTCGACACCCAAATGTCGTTGAATT...

Protein

Download Protein FASTA

442 aa · LXL04_009216|LXL04_009216|OH1004|PROTEIN

MEDFVDTCHGGGDRGGRNIIFGKYEMGRLLGQGTFGKVYYAKDLVSSESVAIKVIKKDQVRKEGLMDQITREISIMRLVRHPNVVELKEVMATKQKIFFVMEYVTGGELFAKVVKGRLKEDVARKYFQQLISAVDFCHSRGVSHRDLKPENLLLDQNGDLKVSDFGLSALPEQLTNDGMLHTQCGTPAYVAPEVLRRKGYDGAKDDIWSCGVILYVLLAGFLPFQDENVMHMYKKIFKAEYEFPQWFSSDARRLISKILM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009216`
TK1151 ID	TkA03G409980
OH-1004 ID	LXL04_009216
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 94.344 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009216

Location Chr02:120647897-120649225 (-)

Description Similar to CIPK25: CBL-interacting serine/threonine-protein kinase 25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25110`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At5g10930`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`At2g25090`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0418000`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release
`Os01g0206700`	CIPK serine-threonine protein kinases interact with CBL proteins.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009216 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006814 sodium ion transport Biological Process

GO:0007165 signal transduction Biological Process

GO:0030007 intracellular potassium ion homeostasis Biological Process

GO:0042538 hyperosmotic salinity response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051592 response to calcium ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT2G25090

ath:AT5G10930

ath:AT5G25110

dosa:Os01g0206700

dosa:Os09g0418000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.497

Rank 1 · LXL04_009216 · OH-1004

Nucleus0.391

Rank 2 · LXL04_009216 · OH-1004

Cell membrane0.250

Rank 3 · LXL04_009216 · OH-1004

Endoplasmic reticulum0.052

Rank 4 · LXL04_009216 · OH-1004

Lysosome / Vacuole0.046

Rank 5 · LXL04_009216 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase24-278 aa

PF07714.24PK_Tyr_Ser-Thr25-273 aa

PF03109.23ABC192-173 aa

PF03822.21NAF309-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009216	`PF00069.32`	Pkinase	24	278	2.3e-77	260.6
LXL04_009216	`PF07714.24`	PK_Tyr_Ser-Thr	25	273	8.1e-38	130.9
LXL04_009216	`PF03109.23`	ABC1	92	173	7.4e-07	29.3
LXL04_009216	`PF03822.21`	NAF	309	365	6.2e-18	65.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8W1D5`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 25	69.355%	Swiss-Prot	strong database homology
`Q9LEU7`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 5	68.636%	Swiss-Prot	strong database homology
`Q9SEZ7`	Arabidopsis thaliana	CBL-interacting serine/threonine-protein kinase 16	60.860%	Swiss-Prot	strong database homology
`Q6ERS4`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 16	59.259%	Swiss-Prot	strong database homology
`Q9LWM4`	Oryza sativa subsp. japonica	CBL-interacting protein kinase 5	56.492%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card