LXL04_009214 | RubberDandelionOmics

Gene overview

LXL04_009214

Reference: OH-1004 Chr: Chr02 Coordinates: 120558717-120562153 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · LXL04_009214|LXL04_009214|OH1004|cDNA

ATGACGTCTTCTCAGCAATCGCAGTTCATGACTAATGCACCGCTAATTAAGAGTTCTGACGCTAATCAGATTGTTGTTCCTGATAAAACAAGCTGGAAAAACTTATTTGCGTACATGGGGCCTGGGTTTCTTGTTTCCATTGCATATATCGATCCTGGAAACTTTGAAACCGATTTACAATCAGGAGCTCAATACAAATATGAGTTACTTTGGATTATACTAGTGGCCTCATGTGCTGCACTTGTCATCCAATCCTTAGC...

CDS

Download CDS FASTA

1575 bp · LXL04_009214|LXL04_009214|OH1004|CDS

ATGACGTCTTCTCAGCAATCGCAGTTCATGACTAATGCACCGCTAATTAAGAGTTCTGACGCTAATCAGATTGTTGTTCCTGATAAAACAAGCTGGAAAAACTTATTTGCGTACATGGGGCCTGGGTTTCTTGTTTCCATTGCATATATCGATCCTGGAAACTTTGAAACCGATTTACAATCAGGAGCTCAATACAAATATGAGTTACTTTGGATTATACTAGTGGCCTCATGTGCTGCACTTGTCATCCAATCCTTAGC...

Protein

Download Protein FASTA

524 aa · LXL04_009214|LXL04_009214|OH1004|PROTEIN

MTSSQQSQFMTNAPLIKSSDANQIVVPDKTSWKNLFAYMGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALVIQSLAANLGVVTGKHLAEHCKNEYEKGTNYILWILAEISIVACDIPEVIGTAFALNMLFHIPVWIGVLLTGFSTLGLLALQQYGVRKLELLITFLVLTIAACFLVELGISKPKASEVLYGMFVPQLKGSGSTGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVSGIKEACRFYLIES...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009214`
TK1151 ID	TkA03G409610
OH-1004 ID	LXL04_009214
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009214

Location Chr02:120558717-120562153 (-)

Description Similar to NRAMP6: Metal transporter Nramp6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g15960`	Probable intracellular cadmium (Cd) transporter that participates in the distribution or availability of Cd within the cell.	The NRAMP6 metal transporter contributes to cadmium toxicity.2009 · DOI: 10.1042/bj20090655
`At1g80830`	High affinity manganese (Mn) transporter involved in Mn acquisition from the soil.	Involvement of NRAMP1 from Arabidopsis thaliana in iron transport.2000 · DOI: 10.1042/bj3470749 High-affinity manganese uptake by the metal transporter NRAMP1 is essential for Arabidopsis growth in low manganese conditions.2010 · DOI: 10.1105/tpc.109.073023

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0676000`	Probable metal transporter.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009214 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006828 manganese ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0015691 cadmium ion transport Biological Process

GO:0015692 lead ion transport Biological Process

GO:0030001 metal ion transport Biological Process

GO:0030003 intracellular monoatomic cation homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0034755 iron ion transmembrane transport Biological Process

GO:0055071 manganese ion homeostasis Biological Process

GO:0070574 cadmium ion transmembrane transport Biological Process

GO:0071421 manganese ion transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G15960

ath:AT1G80830

pop:18094263

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.387

Rank 1 · LXL04_009214 · OH-1004

Cell membrane0.367

Rank 2 · LXL04_009214 · OH-1004

Cytoplasm0.198

Rank 3 · LXL04_009214 · OH-1004

Golgi apparatus0.103

Rank 4 · LXL04_009214 · OH-1004

Endoplasmic reticulum0.100

Rank 5 · LXL04_009214 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01566.26Nramp42-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009214	`PF01566.26`	Nramp	42	440	1.8e-133	446.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9N8`	Arabidopsis thaliana	Metal transporter Nramp6	76.879%	Swiss-Prot	strong database homology
`Q9SAH8`	Arabidopsis thaliana	Metal transporter Nramp1	74.468%	Swiss-Prot	strong database homology
`Q653V6`	Oryza sativa subsp. japonica	Metal transporter Nramp3	70.425%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card