LXL04_009172 | RubberDandelionOmics

Gene overview

LXL04_009172

Reference: OH-1004 Chr: Chr02 Coordinates: 119521384-119524769 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · LXL04_009172|LXL04_009172|OH1004|cDNA

ATGTATATGCAAAAGGATAATGAATGGAAACAAGCCATCAGAGATCAAGCCCAAGAATCAGCCGCATGGAAACTAAAAGAACAAGAGTTAAAAGTGCAGCTTGATAATGAAAAACGAAAGGCTCAAAAGGAAAAACAAGCCTTAATAGATGACTTGAATGAAATGCTAAAGATTACAGAATCCATGAAGGCCCAAATCTCTGATCTACAACAAGAGAATGAGTACTTAAAAAGGAAGACAGTCAAACTGATCAGCACTGT...

CDS

Download CDS FASTA

1728 bp · LXL04_009172|LXL04_009172|OH1004|CDS

ATGTATATGCAAAAGGATAATGAATGGAAACAAGCCATCAGAGATCAAGCCCAAGAATCAGCCGCATGGAAACTAAAAGAACAAGAGTTAAAAGTGCAGCTTGATAATGAAAAACGAAAGGCTCAAAAGGAAAAACAAGCCTTAATAGATGACTTGAATGAAATGCTAAAGATTACAGAATCCATGAAGGCCCAAATCTCTGATCTACAACAAGAGAATGAGTACTTAAAAAGGAAGACAGTCAAACTGATCAGCACTGT...

Protein

Download Protein FASTA

575 aa · LXL04_009172|LXL04_009172|OH1004|PROTEIN

MYMQKDNEWKQAIRDQAQESAAWKLKEQELKVQLDNEKRKAQKEKQALIDDLNEMLKITESMKAQISDLQQENEYLKRKTVKLISTVPRLAAGRNTWCNRRNQDRSCEFYFLNESKNTMSMYGYDVSFHDYGFSDTVIAGSIYGNSLSSMAAAVEYDDELYARRRPPPSRPSPPIITPGSPPRYRHDGTSPLPLGMDWSLAPLIWEGRNSVWPHDLHKGWSYCVTIPSLSSEQSAGSSDAVFYSVKVGIQSPEGITTTRT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009172`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009172

Location Chr02:119521384-119524769 (-)

Description Similar to EREL1: PX domain-containing protein EREL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g32160`	Acts as an effector of RABF2A and RABF2B (By similarity).	No verified direct reference in this release
`At2g25350`	Acts as an effector of RABF2A and RABF2B (By similarity).	No verified direct reference in this release
`At3g15920`	Acts as an effector of RABF2A and RABF2B.	ENDOSOMAL RAB EFFECTOR WITH PX-DOMAIN, an Interacting Partner of RAB5 GTPases, Regulates Membrane Trafficking to Protein Storage Vacuoles in Arabidopsis.2016 · DOI: 10.1105/tpc.16.00326

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009172 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0015031 protein transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0035091 phosphatidylinositol binding Molecular Function

KEGG gene cross-reference

ath:AT2G25350

ath:AT4G32160

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.520

Rank 1 · LXL04_009172 · OH-1004

Nucleus0.281

Rank 2 · LXL04_009172 · OH-1004

Cell membrane0.229

Rank 3 · LXL04_009172 · OH-1004

Golgi apparatus0.109

Rank 4 · LXL04_009172 · OH-1004

Lysosome / Vacuole0.077

Rank 5 · LXL04_009172 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00787.30PX257-332 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009172	`PF00787.30`	PX	257	332	2.9e-13	50.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JTJ2`	Arabidopsis thaliana	PX domain-containing protein EREL1	60.116%	Swiss-Prot	weak database homology
`Q8S8D3`	Arabidopsis thaliana	PX domain-containing protein EREL2	56.647%	Swiss-Prot	weak database homology
`Q9LSB9`	Arabidopsis thaliana	PX domain-containing protein EREX	47.556%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card