LXL04_009139 | RubberDandelionOmics

Gene overview

LXL04_009139

Reference: OH-1004 Chr: Chr02 Coordinates: 118531808-118533832 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1281 bp · LXL04_009139|LXL04_009139|OH1004|cDNA

ATGCCTAGGCCAGCTGCCGGAAAGCAAAGGAAATCGGCCAAGATCCTCTTCGTGTGCGTTGGCCTTCTGGGAGTAGCCCTTATTGCAGATCTACTATGggcttcttctacttcttcCTCTTCACGATCTTACAAATCCGCTTATGATTGGCCCCGGCCTAAAGCTTCTTCCGACTCCTTTCCCGTTCCTGTTTCCTCCAATCACTCTGCCAAGGTCGTAACTGATAAAGACAAAAAAGATGGTGTTCATGGAAGACTTCT...

CDS

Download CDS FASTA

1281 bp · LXL04_009139|LXL04_009139|OH1004|CDS

ATGCCTAGGCCAGCTGCCGGAAAGCAAAGGAAATCGGCCAAGATCCTCTTCGTGTGCGTTGGCCTTCTGGGAGTAGCCCTTATTGCAGATCTACTATGGGCTTCTTCTACTTCTTCCTCTTCACGATCTTACAAATCCGCTTATGATTGGCCCCGGCCTAAAGCTTCTTCCGACTCCTTTCCCGTTCCTGTTTCCTCCAATCACTCTGCCAAGGTCGTAACTGATAAAGACAAAAAAGATGGTGTTCATGGAAGACTTCT...

Protein

Download Protein FASTA

426 aa · LXL04_009139|LXL04_009139|OH1004|PROTEIN

MPRPAAGKQRKSAKILFVCVGLLGVALIADLLWASSTSSSSRSYKSAYDWPRPKASSDSFPVPVSSNHSAKVVTDKDKKDGVHGRLLSKTFADLPAPDLKWEKMAESPVPRLDGAAIQIHDQLFVFAGYGTIDLVHSHVDIYNFTSNKWGGRFDMPKEMAHSHLGMVTDGRYIYIVTGQYGPQCRGPTAHTFILDTKTKTWKNMPPLPLPRYAPATQLWRGRLHVMGGSKEDRYTPAVDHWSLAVKDGKVLDSEWKTELP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009139`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009139

Location Chr02:118531808-118533832 (-)

Description Similar to At3g27220: Kelch repeat-containing protein At3g27220

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27220`	Kelch repeat-containing protein At3g27220.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009139 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009061 anaerobic respiration Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0098813 nuclear chromosome segregation Biological Process

GO:0140014 mitotic nuclear division Biological Process

GO:1902410 mitotic cytokinetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT3G27220

hsa:200942

hsa:55220

mmu:78267

rno:306589

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.490

Rank 1 · LXL04_009139 · OH-1004

Golgi apparatus0.210

Rank 2 · LXL04_009139 · OH-1004

Cytoplasm0.173

Rank 3 · LXL04_009139 · OH-1004

Cell membrane0.133

Rank 4 · LXL04_009139 · OH-1004

Nucleus0.104

Rank 5 · LXL04_009139 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24681.2Kelch_KLHDC2_KLHL20_DRC7100-205 aa

PF13964.13Beta-prop_Calicin101-283 aa

PF24981.2Beta-prop_ATRN-LZTR1115-287 aa

PF24681.2Kelch_KLHDC2_KLHL20_DRC7157-347 aa

PF25210.2Kelch_FKB95159-293 aa

PF01344.32Kelch_1162-208 aa

PF13415.13Beta-prop_FBX42165-286 aa

PF13415.13Beta-prop_FBX42267-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009139	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	100	205	9.7e-29	100.9
LXL04_009139	`PF13964.13`	Beta-prop_Calicin	101	283	1.5e-12	47.9
LXL04_009139	`PF24981.2`	Beta-prop_ATRN-LZTR1	115	287	6.4e-13	49.3
LXL04_009139	`PF24681.2`	Kelch_KLHDC2_KLHL20_DRC7	157	347	9.7e-29	100.9
LXL04_009139	`PF25210.2`	Kelch_FKB95	159	293	2e-14	54.6
LXL04_009139	`PF01344.32`	Kelch_1	162	208	4e-16	58.9
LXL04_009139	`PF13415.13`	Beta-prop_FBX42	165	286	1.9e-17	64.3
LXL04_009139	`PF13415.13`	Beta-prop_FBX42	267	377	1.9e-17	64.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK31`	Arabidopsis thaliana	Kelch repeat-containing protein At3g27220	61.893%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card