LXL04_009136 | RubberDandelionOmics

Gene overview

LXL04_009136

Reference: OH-1004 Chr: Chr02 Coordinates: 118521211-118522598 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

885 bp · LXL04_009136|LXL04_009136|OH1004|cDNA

ATGGACGACCTCCATGAAAACGAATCAGCAATGCAGATGGCAGACGACAATCCACCATACCATCCCCAACATTACATACAAGATCAAGAACACGAAGACTTACATCATTTAAGTAATGGAAACATGATTCACCATGATGAACAACAGGATAATGAAATTGGTGTTGGCCAAAACGATCCCATGGAAGATCCAGGAAACATGTCAGATAACCATAACACATTATTATCCCGTGGCACCATTGAAGATACAAACCAGCTCAC...

CDS

Download CDS FASTA

885 bp · LXL04_009136|LXL04_009136|OH1004|CDS

ATGGACGACCTCCATGAAAACGAATCAGCAATGCAGATGGCAGACGACAATCCACCATACCATCCCCAACATTACATACAAGATCAAGAACACGAAGACTTACATCATTTAAGTAATGGAAACATGATTCACCATGATGAACAACAGGATAATGAAATTGGTGTTGGCCAAAACGATCCCATGGAAGATCCAGGAAACATGTCAGATAACCATAACACATTATTATCCCGTGGCACCATTGAAGATACAAACCAGCTCAC...

Protein

Download Protein FASTA

294 aa · LXL04_009136|LXL04_009136|OH1004|PROTEIN

MDDLHENESAMQMADDNPPYHPQHYIQDQEHEDLHHLSNGNMIHHDEQQDNEIGVGQNDPMEDPGNMSDNHNTLLSRGTIEDTNQLTLSFQGQVYVFDSVSPEKVQAVLLLLGGRETSSSMPYMSLTNHHQSNRDLATTQPRLNVPHRLASLMRFREKRKERNFEKKIRYTVRKEVALRMQRNKGQFTSSKPVNEDSATSWESNQGWQSDGSGSQHQETACRHCGTNEKSTPLMRRGPDGPRTLCNACGLMWANKGTLRD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009136`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009136

Location Chr02:118521211-118522598 (-)

Description Similar to GATA28: GATA transcription factor 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51600`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	Characterization of Arabidopsis ZIM, a member of a novel plant-specific GATA factor gene family.2004 · DOI: 10.1093/jxb/erh078
`At3g21175`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	Characterization of Arabidopsis ZIM, a member of a novel plant-specific GATA factor gene family.2004 · DOI: 10.1093/jxb/erh078

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0698900`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`Os02g0148500`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`UniProt: A2XKR7`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009136 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G51600

ath:AT3G21175

dosa:Os02g0148500

dosa:Os06g0698900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · LXL04_009136 · OH-1004

Cytoplasm0.136

Rank 2 · LXL04_009136 · OH-1004

Cell membrane0.035

Rank 3 · LXL04_009136 · OH-1004

Endoplasmic reticulum0.022

Rank 4 · LXL04_009136 · OH-1004

Plastid0.011

Rank 5 · LXL04_009136 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06200.20tify83-113 aa

PF06203.20CCT148-190 aa

PF09425.16Jas_motif148-170 aa

PF00320.34GATA221-257 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009136	`PF06200.20`	tify	83	113	3.6e-13	49.3
LXL04_009136	`PF06203.20`	CCT	148	190	3.4e-16	59.7
LXL04_009136	`PF09425.16`	Jas_motif	148	170	1.8e-07	31.5
LXL04_009136	`PF00320.34`	GATA	221	257	4.2e-14	52.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1G0`	Arabidopsis thaliana	GATA transcription factor 28	54.934%	Swiss-Prot	strong database homology
`Q8GXL7`	Arabidopsis thaliana	GATA transcription factor 24	56.250%	Swiss-Prot	strong database homology
`Q5Z4U5`	Oryza sativa subsp. japonica	GATA transcription factor 20	55.061%	Swiss-Prot	strong database homology
`Q6Z433`	Oryza sativa subsp. japonica	GATA transcription factor 17	60.656%	Swiss-Prot	moderate database homology
`A2XKR7`	Oryza sativa subsp. indica	GATA transcription factor 18	53.810%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card