LXL04_009119 | RubberDandelionOmics

Gene overview

LXL04_009119

Reference: OH-1004 Chr: Chr02 Coordinates: 118144887-118149706 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2325 bp · LXL04_009119|LXL04_009119|OH1004|cDNA

ATGCTCCCAAATCGCCCCCTTGCTGTCCAAAGTCGTGGTCTCGAAACCTTGCTGTTCTCCCCATTTAACAGGTCAAAACGCGAAAAGACGGAACTACCCTTAGTGAGCTGCGCGGGTCGCGCAGGTCCAAGGCCAAATCCTGCGCGGGTCGCGCACGCTGTGCATGCCCAAAAATATCTTCATTTTCAGCCCAATTCTTCTAAGCCCATCATCTTCTATCTTCTCCCAACATTGtTAAACAATCAAAAAATATTTGTGAA...

CDS

Download CDS FASTA

2325 bp · LXL04_009119|LXL04_009119|OH1004|CDS

ATGCTCCCAAATCGCCCCCTTGCTGTCCAAAGTCGTGGTCTCGAAACCTTGCTGTTCTCCCCATTTAACAGGTCAAAACGCGAAAAGACGGAACTACCCTTAGTGAGCTGCGCGGGTCGCGCAGGTCCAAGGCCAAATCCTGCGCGGGTCGCGCACGCTGTGCATGCCCAAAAATATCTTCATTTTCAGCCCAATTCTTCTAAGCCCATCATCTTCTATCTTCTCCCAACATTGTTAAACAATCAAAAAATATTTGTGAA...

Protein

Download Protein FASTA

774 aa · LXL04_009119|LXL04_009119|OH1004|PROTEIN

MLPNRPLAVQSRGLETLLFSPFNRSKREKTELPLVSCAGRAGPRPNPARVAHAVHAQKYLHFQPNSSKPIIFYLLPTLLNNQKIFVKSTDRISLAGGRSEDGIFLTMDDEVPTKKEAKNNPKIESLLLPLILSLSISSLPLKHLQLSSQSPRLLAHTQRLCTSNLFLQLIWTKVKAVTVRPSGPNLGIRCGDMSLFGNVSAINASGKCTVMNLSSTQIPSRDCFTQKHVLSFGYCDAMGHRLQFPTARSFTPRSKKNASL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009119`
TK1151 ID	TkA03G399310
OH-1004 ID	LXL04_009119
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	89.200
Protein coverage (%)	TK1151 52.083 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009119

Location Chr02:118144887-118149706 (+)

Description Similar to PDS: 15-cis-phytoene desaturase, chloroplastic/chromoplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g14210`	Converts phytoene into zeta-carotene via the intermediary of phytofluene by the symmetrical introduction of two double bonds at the C-11 and C-11' positions of phytoene with a concomitant isomerization of two neighboring double bonds at the C9 and C9' positions from trans to cis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009119 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009635 response to herbicide Biological Process

GO:0016117 carotenoid biosynthetic process Biological Process

GO:0016120 carotene biosynthetic process Biological Process

GO:0051289 protein homotetramerization Biological Process

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009509 chromoplast Cellular Component

GO:0009534 chloroplast thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016020 membrane Cellular Component

GO:0016166 phytoene dehydrogenase activity Molecular Function

GO:0071949 FAD binding Molecular Function

KEGG gene cross-reference

ath:AT4G14210

cann:107861625

gmx:547970

sly:544073

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.976

Rank 1 · LXL04_009119 · OH-1004

Mitochondrion0.033

Rank 2 · LXL04_009119 · OH-1004

Cytoplasm0.026

Rank 3 · LXL04_009119 · OH-1004

Nucleus0.019

Rank 4 · LXL04_009119 · OH-1004

Peroxisome0.017

Rank 5 · LXL04_009119 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01266.31DAO300-335 aa

PF13450.13NAD_binding_8303-369 aa

PF01593.31Amino_oxidase308-754 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009119	`PF01266.31`	DAO	300	335	3.8e-09	37.3
LXL04_009119	`PF13450.13`	NAD_binding_8	303	369	4.9e-14	53.1
LXL04_009119	`PF01593.31`	Amino_oxidase	308	754	7.7e-88	296.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q07356`	Arabidopsis thaliana	15-cis-phytoene desaturase, chloroplastic/chromoplastic	79.304%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card