LXL04_009079 | RubberDandelionOmics

Gene overview

LXL04_009079

Reference: OH-1004 Chr: Chr02 Coordinates: 117508308-117510913 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1761 bp · LXL04_009079|LXL04_009079|OH1004|cDNA

ATGTTGGGCTGTATCATCAACCCTCAACACAACAAATCGGAAGACGCCTTTCACTTTCGCATACATCGCACATCGCACAAACACATCGCCACACACAGCGCAGCTCCGACTTCCTCCTCCCTTGTCGCTGCCAGCCGCCGTCCCAGCCACATCCACCTCCGATTCCACCTCCGGCACACACAGGCATACAATCGCCAAAACTTACTTCCAACAATGGGGCGAAAGAAGAAATTCATAGACAAGAAAAAGTCAGCCACTTT...

CDS

Download CDS FASTA

1761 bp · LXL04_009079|LXL04_009079|OH1004|CDS

ATGTTGGGCTGTATCATCAACCCTCAACACAACAAATCGGAAGACGCCTTTCACTTTCGCATACATCGCACATCGCACAAACACATCGCCACACACAGCGCAGCTCCGACTTCCTCCTCCCTTGTCGCTGCCAGCCGCCGTCCCAGCCACATCCACCTCCGATTCCACCTCCGGCACACACAGGCATACAATCGCCAAAACTTACTTCCAACAATGGGGCGAAAGAAGAAATTCATAGACAAGAAAAAGTCAGCCACTTT...

Protein

Download Protein FASTA

586 aa · LXL04_009079|LXL04_009079|OH1004|PROTEIN

MLGCIINPQHNKSEDAFHFRIHRTSHKHIATHSAAPTSSSLVAASRRPSHIHLRFHLRHTQAYNRQNLLPTMGRKKKFIDKKKSATFQLMSRDSSDPNYSEGPSGDRVFVRVDGNSEKPLFDGEQSDEDGPDGIFDDAPEDEEEEDGGNAVNQTRSGLPDHLRTEILELGFPDDGYNYLSHLREIKDTGGGSAFYQNPKAARPDQLPRDVKAYDASRIEVSKGNDEASYKNSIYGVAVNTVPVRIQKAIDPEVAALLDDS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009079`
TK1151 ID	TkA03G396590
OH-1004 ID	LXL04_009079
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.800
Protein coverage (%)	TK1151 100.000 / OH-1004 99.147 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_009079`
Location	Chr02:117508308-117510913 (+)
Description	Similar to LTV1: Protein LTV1 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_009079` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0000056 ribosomal small subunit export from nucleus Biological Process GO:0006364 rRNA processing Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0042274 ribosomal small subunit biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component GO:0043022 ribosome binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0275601 dme:Dmel_CG7686 pon:100190824 rno:361452 xla:443630 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.667

Rank 1 · LXL04_009079 · OH-1004

Nucleus0.343

Rank 2 · LXL04_009079 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_009079 · OH-1004

Endoplasmic reticulum0.054

Rank 4 · LXL04_009079 · OH-1004

Golgi apparatus0.053

Rank 5 · LXL04_009079 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04180.20LTV80-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009079	`PF04180.20`	LTV	80	353	2.6e-07	31.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card