LXL04_009021 | RubberDandelionOmics

Gene overview

LXL04_009021

Reference: OH-1004 Chr: Chr02 Coordinates: 116300233-116301134 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

444 bp · LXL04_009021|LXL04_009021|OH1004|cDNA

ATGATATTAAGGCTTCTGGAGGGACTTCCAACAATGCTGAAGGGTGAAGTTGCAATGTTAAAAATAAAACCTGAATTGCACTATGGGGAGGATGACTGTCCAGTCTCTGCTTCAGATAGCTTTCCAAAGGATGCTAAACTTAATTTTGAGATTGAGCTTATAGATTTTTCTAAAATTGTAACAGAAGATTTTGGAGTATTAAAGAAGGTTGTACACAAGGCACAAAGTTGGGAAAACCCAAGGGATCTCTATGAAGTAAA...

CDS

Download CDS FASTA

444 bp · LXL04_009021|LXL04_009021|OH1004|CDS

ATGATATTAAGGCTTCTGGAGGGACTTCCAACAATGCTGAAGGGTGAAGTTGCAATGTTAAAAATAAAACCTGAATTGCACTATGGGGAGGATGACTGTCCAGTCTCTGCTTCAGATAGCTTTCCAAAGGATGCTAAACTTAATTTTGAGATTGAGCTTATAGATTTTTCTAAAATTGTAACAGAAGATTTTGGAGTATTAAAGAAGGTTGTACACAAGGCACAAAGTTGGGAAAACCCAAGGGATCTCTATGAAGTAAA...

Protein

Download Protein FASTA

147 aa · LXL04_009021|LXL04_009021|OH1004|PROTEIN

MILRLLEGLPTMLKGEVAMLKIKPELHYGEDDCPVSASDSFPKDAKLNFEIELIDFSKIVTEDFGVLKKVVHKAQSWENPRDLYEVNAMISAKLGNGQPLQLHKNSEPILFTFGKSEVPKGLEMGIGTTCYLVATCWPRNGGSVIVK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009021`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009021

Location Chr02:116300233-116301134 (-)

Description Similar to PAS1: Peptidyl-prolyl cis-trans isomerase PASTICCINO1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54010`	PPIases accelerate the folding of proteins.	Very-long-chain fatty acids are involved in polar auxin transport and developmental patterning in Arabidopsis.2010 · DOI: 10.1105/tpc.109.071209 The PASTICCINO genes of Arabidopsis thaliana are involved in the control of cell division and differentiation.1998 · DOI: 10.1242/dev.125.5.909 Mutation in the Arabidopsis PASTICCINO1 gene, which encodes a new FK506-binding protein-like protein, has a dramatic effect on plant development.1998 · DOI: 10.1128/mcb.18.5.3034
`At3g25230`	PPIases accelerate the folding of proteins.	Arabidopsis immunophilins ROF1 (AtFKBP62) and ROF2 (AtFKBP65) exhibit tissue specificity, are heat-stress induced, and bind HSP90.2007 · DOI: 10.1007/s11103-006-9085-z Arabidopsis ROF1 (FKBP62) modulates thermotolerance by interacting with HSP90.1 and affecting the accumulation of HsfA2-regulated sHSPs.2009 · DOI: 10.1111/j.1365-313x.2009.03878.x
`At5g48570`	PPIases accelerate the folding of proteins.	Involvement of Arabidopsis ROF2 (FKBP65) in thermotolerance.2010 · DOI: 10.1007/s11103-009-9561-3 Peptidyl-prolyl cis-trans isomerase ROF2 modulates intracellular pH homeostasis in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2012.04921.x Characterization of three Arabidopsis thaliana immunophilin genes involved in the plant defense response against Pseudomonas syringae.2014 · DOI: 10.1016/j.gene.2014.01.029

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009021 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009408 response to heat Biological Process

GO:0009611 response to wounding Biological Process

GO:0009644 response to high light intensity Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009735 response to cytokinin Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009845 seed germination Biological Process

GO:0009880 embryonic pattern specification Biological Process

KEGG gene cross-reference

ath:AT3G25230

ath:AT3G54010

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.579

Rank 1 · LXL04_009021 · OH-1004

Nucleus0.339

Rank 2 · LXL04_009021 · OH-1004

Endoplasmic reticulum0.101

Rank 3 · LXL04_009021 · OH-1004

Mitochondrion0.082

Rank 4 · LXL04_009021 · OH-1004

Cell membrane0.075

Rank 5 · LXL04_009021 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00254.35FKBP_C5-54 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009021	`PF00254.35`	FKBP_C	5	54	5.4e-13	49.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7DMA9`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase PASTICCINO1	62.121%	Swiss-Prot	strong database homology
`Q38931`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP62	42.391%	Swiss-Prot	moderate database homology
`Q9FJL3`	Arabidopsis thaliana	Peptidyl-prolyl cis-trans isomerase FKBP65	40.217%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card