LXL04_008975 | RubberDandelionOmics

Gene overview

LXL04_008975

Reference: OH-1004 Chr: Chr02 Coordinates: 114707225-114710708 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1089 bp · LXL04_008975|LXL04_008975|OH1004|cDNA

ATGGAGGTTAATATCCGAGGCGgcttctctcttcttcttttcgcTATCTTCCTTTCAGGATATGAGGTTTCAGCAGCTGTGTTTAGGTTACAAAACAACTGTAGCTATACAGTTTGGCCGGGGACGCTTTCCGGCAATGACGGTGTTTCCTTAGGCGACGGCGGATTCTCATTATCACCTGGCGCCTCTGTCGAGTTCCCTGCAATGCCAGGCTGGTCAGGCCGATTTTGGGCTCGAACCGGTTGCACTTTCGATGAGTT...

CDS

Download CDS FASTA

1089 bp · LXL04_008975|LXL04_008975|OH1004|CDS

ATGGAGGTTAATATCCGAGGCGGCTTCTCTCTTCTTCTTTTCGCTATCTTCCTTTCAGGATATGAGGTTTCAGCAGCTGTGTTTAGGTTACAAAACAACTGTAGCTATACAGTTTGGCCGGGGACGCTTTCCGGCAATGACGGTGTTTCCTTAGGCGACGGCGGATTCTCATTATCACCTGGCGCCTCTGTCGAGTTCCCTGCAATGCCAGGCTGGTCAGGCCGATTTTGGGCTCGAACCGGTTGCACTTTCGATGAGTT...

Protein

Download Protein FASTA

362 aa · LXL04_008975|LXL04_008975|OH1004|PROTEIN

MEVNIRGGFSLLLFAIFLSGYEVSAAVFRLQNNCSYTVWPGTLSGNDGVSLGDGGFSLSPGASVEFPAMPGWSGRFWARTGCTFDEFGNGNCQTGDCGSTLKCNGGGAPPVSLAEFTIGGGISNSDKDFYDVSLVDGYNVGIGIRPTGGAGDCLYAGCIADLNIKCPAELRVVDNNGVVVACRSACDAFKGAEFCCTGDHATPATCAPTKFSEMFKEACPSAYSYAYDDASSTFTCSGSDYLVTFCPTSDETIFDQMDTF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008975`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008975

Location Chr02:114707225-114710708 (-)

Description Similar to Pathogenesis-related thaumatin-like protein 3.5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75040`	Partially responsible for acquired pathogen resistance.	No verified direct reference in this release
`At4g24180`	Involved in local responses of roots to colonization by non-pathogenic plant growth-promoting rhizobacteria (PGPR) fluorescent Pseudomonas spp., but does not seem to be required for the establishment of subsequent induced systemic resistance (ISR).	No verified direct reference in this release
`At1g18250`	Thaumatin-like protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008975 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0009615 response to virus Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009723 response to ethylene Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010224 response to UV-B Biological Process

GO:0031540 regulation of anthocyanin biosynthetic process Biological Process

GO:0046686 response to cadmium ion Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G18250

ath:AT1G75040

ath:AT4G24180

mdm:103411735

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.213

Rank 1 · LXL04_008975 · OH-1004

Cell membrane0.203

Rank 2 · LXL04_008975 · OH-1004

Lysosome / Vacuole0.200

Rank 3 · LXL04_008975 · OH-1004

Extracellular0.178

Rank 4 · LXL04_008975 · OH-1004

Cytoplasm0.144

Rank 5 · LXL04_008975 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00314.23Thaumatin32-247 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008975	`PF00314.23`	Thaumatin	32	247	6.5e-80	268.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P28493`	Arabidopsis thaliana	Pathogenesis-related protein 5	61.603%	Swiss-Prot	moderate database homology
`A0A1P8B554`	Arabidopsis thaliana	Thaumatin-like protein 1	53.279%	Swiss-Prot	moderate database homology
`P50699`	Arabidopsis thaliana	Thaumatin-like protein	51.754%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card