LXL04_008949 | RubberDandelionOmics

Gene overview

LXL04_008949

Reference: OH-1004 Chr: Chr02 Coordinates: 113865826-113869195 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1932 bp · LXL04_008949|LXL04_008949|OH1004|cDNA

ATGGAGAGAGTTGGTCGAACGGCTCGCGTGTCGATGCGGTACAGTCTTTCACAGAGATCCTTCGAAAATGAAGCTAGTTCTTCTGATATGACGCATGTGAAAAACCAAGACAACGACGTCGATTTCGATGACGTGTTTGGTGGACCTCCGACGCGGACGAGATACAGTTTTGGTGGTGGAAGAATCAAGTCATCGGAGGAGTCCACCAGTTCCCCGTCTGGACTGGGTGACAGGCCGGTTTTCGGAGAGTCGTATAGTTC...

CDS

Download CDS FASTA

1932 bp · LXL04_008949|LXL04_008949|OH1004|CDS

ATGGAGAGAGTTGGTCGAACGGCTCGCGTGTCGATGCGGTACAGTCTTTCACAGAGATCCTTCGAAAATGAAGCTAGTTCTTCTGATATGACGCATGTGAAAAACCAAGACAACGACGTCGATTTCGATGACGTGTTTGGTGGACCTCCGACGCGGACGAGATACAGTTTTGGTGGTGGAAGAATCAAGTCATCGGAGGAGTCCACCAGTTCCCCGTCTGGACTGGGTGACAGGCCGGTTTTCGGAGAGTCGTATAGTTC...

Protein

Download Protein FASTA

643 aa · LXL04_008949|LXL04_008949|OH1004|PROTEIN

MERVGRTARVSMRYSLSQRSFENEASSSDMTHVKNQDNDVDFDDVFGGPPTRTRYSFGGGRIKSSEESTSSPSGLGDRPVFGESYSSPRRPTSDDFYDDIFRSSSESARSPKWSSPTSGSRVLNPAHPKIESFASSLPTEFSLPPRMTKAVDIPVFGSNPNASTTILSRFSSPTTQGRDVFGNNQEQQSTENETVHKSKPRTARTGSPSNEFHFSIHKWANVGVPLLISLRGSKVTALSMETIQDSAFQTDNLPSTEKED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008949`
TK1151 ID	TkA03G305710
OH-1004 ID	LXL04_008949
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008949

Location Chr02:113865826-113869195 (+)

Description Similar to JAC1: J domain-containing protein required for chloroplast accumulation response 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g75100`	Required for chloroplast photorelocation movement; chloroplast accumulation upon low blue light and for chloroplast movement to the bottom of cells in darkness, by modulating chloroplast actin (Cp-actin) filaments distribution, appearance and disappearance.	An auxilin-like J-domain protein, JAC1, regulates phototropin-mediated chloroplast movement in Arabidopsis.2005 · DOI: 10.1104/pp.105.067371 Overexpression of an auxilin-like gene (F9E10.5) can suppress Al uptake in roots of Arabidopsis.2007 · DOI: 10.1093/jxb/erl221 Crystallographic and functional analyses of J-domain of JAC1 essential for chloroplast photorelocation movement in Arabidopsis thaliana.2010 · DOI: 10.1093/pcp/pcq089 Red light, Phot1 and JAC1 modulate Phot2-dependent reorganization of chloroplast actin filaments and chloroplast avoidance movement.2011 · DOI: 10.1093/pcp/pcr087
`At4g12780`	Promotes uncoating of clathrin-coated vesicles.	No verified direct reference in this release
`At4g12770`	Promotes probably uncoating of clathrin-coated vesicles.	No verified direct reference in this release
`At1g75310`	Auxilin-like protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008949 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006457 protein folding Biological Process

GO:0006898 receptor-mediated endocytosis Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0007030 Golgi organization Biological Process

GO:0009903 chloroplast avoidance movement Biological Process

GO:0009904 chloroplast accumulation movement Biological Process

GO:0034067 protein localization to Golgi apparatus Biological Process

GO:0045806 negative regulation of endocytosis Biological Process

GO:0045926 negative regulation of growth Biological Process

GO:0046907 intracellular transport Biological Process

GO:0048268 clathrin coat assembly Biological Process

KEGG gene cross-reference

ath:AT1G75100

ath:AT1G75310

ath:AT4G12770

ath:AT4G12780

hsa:2580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.458

Rank 1 · LXL04_008949 · OH-1004

Nucleus0.284

Rank 2 · LXL04_008949 · OH-1004

Cell membrane0.232

Rank 3 · LXL04_008949 · OH-1004

Endoplasmic reticulum0.115

Rank 4 · LXL04_008949 · OH-1004

Golgi apparatus0.092

Rank 5 · LXL04_008949 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C9Q4`	Arabidopsis thaliana	J domain-containing protein required for chloroplast accumulation response 1	59.441%	Swiss-Prot	weak database homology
`Q9SU08`	Arabidopsis thaliana	Auxilin-related protein 1	60.870%	Swiss-Prot	weak database homology
`Q0WQ57`	Arabidopsis thaliana	Auxilin-related protein 2	59.783%	Swiss-Prot	weak database homology
`Q9FWS1`	Arabidopsis thaliana	Auxilin-like protein 1	53.261%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card