LXL04_008927 | RubberDandelionOmics

Gene overview

LXL04_008927

Reference: OH-1004 Chr: Chr02 Coordinates: 112647582-112650040 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1902 bp · LXL04_008927|LXL04_008927|OH1004|cDNA

ATGCTGAATGTTTCCTTTTGGTGCCCCTGTGATTCTAAAAACGattataaaattgattttaCCTGTGATTCTAAAATTGATTGTTGCTGTGATTCTGATTCCATGAAGTTATTGTTTACCTTTGATGAAAAACCATTGAATTACTACTGTGATTTTACCTTAGATGAAATTAATCCAGCAATGGATGAGGCCAAAGAGACTCAATTTCAGGCGAAGAAAACACCAGCCTTCACTGTACTGAAGAACGGTTCCATCCTCAA...

CDS

Download CDS FASTA

1902 bp · LXL04_008927|LXL04_008927|OH1004|CDS

ATGCTGAATGTTTCCTTTTGGTGCCCCTGTGATTCTAAAAACGATTATAAAATTGATTTTACCTGTGATTCTAAAATTGATTGTTGCTGTGATTCTGATTCCATGAAGTTATTGTTTACCTTTGATGAAAAACCATTGAATTACTACTGTGATTTTACCTTAGATGAAATTAATCCAGCAATGGATGAGGCCAAAGAGACTCAATTTCAGGCGAAGAAAACACCAGCCTTCACTGTACTGAAGAACGGTTCCATCCTCAA...

Protein

Download Protein FASTA

633 aa · LXL04_008927|LXL04_008927|OH1004|PROTEIN

MLNVSFWCPCDSKNDYKIDFTCDSKIDCCCDSDSMKLLFTFDEKPLNYYCDFTLDEINPAMDEAKETQFQAKKTPAFTVLKNGSILKNIFLLPKSSPFSPDEEVLLVGRHPDCNITLEHPSISRYHLRIHLNPSSHLLSIIDLSSVHGTWVSGKKIKPGVHVKMEEGDTVKMGGSSRVYELHWVPLSQAFDVNDPFVPSMFRKQEETQDESCSYLETHSSEEDLERSDFSFFNHETIKDDLFSVPNPLDSSIDVSIQTPP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008927`
TK1151 ID	TkA03G310270
OH-1004 ID	LXL04_008927
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 90.521 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008927

Location Chr02:112647582-112650040 (-)

Description Similar to PS1: FHA domain-containing protein PS1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34355`	Required for normal spindle orientation at male meiosis II and normal formation of tetrad of microspores.	No verified direct reference in this release
`At5g47790`	Inhibitor of protein-phosphatase 1 (PP1).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008927 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0051295 establishment of meiotic spindle localization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031965 nuclear membrane Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0004864 protein phosphatase inhibitor activity Molecular Function

KEGG gene cross-reference

ath:AT1G34355

ath:AT5G47790

cel:CELE_ZK632.2

hsa:22950

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.753

Rank 1 · LXL04_008927 · OH-1004

Cytoplasm0.279

Rank 2 · LXL04_008927 · OH-1004

Cell membrane0.042

Rank 3 · LXL04_008927 · OH-1004

Mitochondrion0.032

Rank 4 · LXL04_008927 · OH-1004

Endoplasmic reticulum0.027

Rank 5 · LXL04_008927 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16697.11Yop-YscD_cpl101-173 aa

PF00498.32FHA106-173 aa

PF13638.13PIN_4464-584 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008927	`PF16697.11`	Yop-YscD_cpl	101	173	2.9e-07	31.4
LXL04_008927	`PF00498.32`	FHA	106	173	5.7e-16	59.4
LXL04_008927	`PF13638.13`	PIN_4	464	584	8.6e-16	59.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`B7SY83`	Arabidopsis thaliana	FHA domain-containing protein PS1	43.646%	Swiss-Prot	weak database homology
`Q9FIK2`	Arabidopsis thaliana	Protein phosphatase 1 regulatory inhibitor subunit PPP1R8 homolog	32.727%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card