LXL04_008854 | RubberDandelionOmics

Gene overview

LXL04_008854

Reference: OH-1004 Chr: Chr02 Coordinates: 110474942-110475931 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

360 bp · LXL04_008854|LXL04_008854|OH1004|cDNA

ATGGCAACAGAAGGAGTTGTTATCGGCTGCCACACCGTCGACCAATGGGAGGAGCAGTTTCAGAAGCACGTCGATTCTGAGAAATTGGTAGTTGTGGATTTCACAGCCACATGGTGTGGTCCTTGCCGTGTGATTGCACCAATTTATGCTGAATTAGCTAAAAAGATGCCCCATGTCACCTTCCTCAAGGTCGATGTTGATGAACTTGAGAGCATTGCTCAGAAGTACTCGGTGGAGGCAATGCCAACATTCTTGTTCTT...

CDS

Download CDS FASTA

360 bp · LXL04_008854|LXL04_008854|OH1004|CDS

ATGGCAACAGAAGGAGTTGTTATCGGCTGCCACACCGTCGACCAATGGGAGGAGCAGTTTCAGAAGCACGTCGATTCTGAGAAATTGGTAGTTGTGGATTTCACAGCCACATGGTGTGGTCCTTGCCGTGTGATTGCACCAATTTATGCTGAATTAGCTAAAAAGATGCCCCATGTCACCTTCCTCAAGGTCGATGTTGATGAACTTGAGAGCATTGCTCAGAAGTACTCGGTGGAGGCAATGCCAACATTCTTGTTCTT...

Protein

Download Protein FASTA

119 aa · LXL04_008854|LXL04_008854|OH1004|PROTEIN

MATEGVVIGCHTVDQWEEQFQKHVDSEKLVVVDFTATWCGPCRVIAPIYAELAKKMPHVTFLKVDVDELESIAQKYSVEAMPTFLFFKKGEIVDKVVGAKKDDLHACVAKHEGGVSVSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_008854`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_008854

Location Chr02:110474942-110475931 (+)

Description Similar to Thioredoxin H-type 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51030`	Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YIW7`	Participates in various redox reactions through the reversible oxidation of the active center dithiol to a disulfide.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008854 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006979 response to oxidative stress Biological Process

GO:0009409 response to cold Biological Process

GO:0010497 plasmodesmata-mediated intercellular transport Biological Process

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004857 enzyme inhibitor activity Molecular Function

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT3G51030

nta:107762104

rcu:8266412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.712

Rank 1 · LXL04_008854 · OH-1004

Nucleus0.338

Rank 2 · LXL04_008854 · OH-1004

Mitochondrion0.134

Rank 3 · LXL04_008854 · OH-1004

Cell membrane0.102

Rank 4 · LXL04_008854 · OH-1004

Endoplasmic reticulum0.101

Rank 5 · LXL04_008854 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00085.27Thioredoxin17-109 aa

PF13098.14Thioredoxin_220-101 aa

PF14595.13Thioredoxin_925-90 aa

PF13905.13Thioredoxin_828-72 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_008854	`PF00085.27`	Thioredoxin	17	109	1e-31	109.7
LXL04_008854	`PF13098.14`	Thioredoxin_2	20	101	8.6e-08	33.2
LXL04_008854	`PF14595.13`	Thioredoxin_9	25	90	3.7e-06	27.5
LXL04_008854	`PF13905.13`	Thioredoxin_8	28	72	5.7e-06	27.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29448`	Arabidopsis thaliana	Thioredoxin H1	64.815%	Swiss-Prot	strong database homology
`A2YIW7`	Oryza sativa subsp. indica	Thioredoxin H-type	59.322%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card