Gene Card
Gene overview
cDNA / CDS / Protein Sequences
348 bp · LXL04_008853|LXL04_008853|OH1004|cDNA
ATGGCGGAAGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATTCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTCCATGCCGTATGATTGCACCAATTTTTGCTGATTTAGCTAAAAAGATGCCCAACGTTGTCTTCCTTAAGGTCGATGTGGATGAACTCGAGAGCGTTGCTCAGGAGTACTCAGTGGAGGCCATGCCGACATTCTTGTTTCT...
348 bp · LXL04_008853|LXL04_008853|OH1004|CDS
ATGGCGGAAGAAGGAGTTGTGATTGCCTGCCACACTGTTGATCACTGGAAGGAGCAGTTGGAAAAGCACAAGGATTCTAAGAAACTGGTGGTAGTGGATTTCACCGCCACTTGGTGTGGTCCATGCCGTATGATTGCACCAATTTTTGCTGATTTAGCTAAAAAGATGCCCAACGTTGTCTTCCTTAAGGTCGATGTGGATGAACTCGAGAGCGTTGCTCAGGAGTACTCAGTGGAGGCCATGCCGACATTCTTGTTTCT...
Protein
Download Protein FASTA115 aa · LXL04_008853|LXL04_008853|OH1004|PROTEIN
MAEEGVVIACHTVDHWKEQLEKHKDSKKLVVVDFTATWCGPCRMIAPIFADLAKKMPNVVFLKVDVDELESVAQEYSVEAMPTFLFLKDGEIVHKVVGAKKDEIVSSVEKYAANA
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_008853 |
|---|---|
| TK1151 ID | TkA03G321900 |
| OH-1004 ID | LXL04_008853 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_008853 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr02:110424651-110425397 (+) | |||||||||
| Description | Similar to TRX1: Thioredoxin H1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0009408 response to heat Biological Process GO:0009409 response to cold Biological Process GO:0010188 response to microbial phytotoxin Biological Process GO:0010286 heat acclimation Biological Process GO:0043085 positive regulation of catalytic activity Biological Process GO:0050832 defense response to fungus Biological Process GO:0051259 protein complex oligomerization Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT3G51030 ath:AT5G42980 nta:107762104 rcu:8266412 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00085.27Thioredoxin9-109 aaPF13899.13Thioredoxin_715-87 aaPF13098.14Thioredoxin_217-108 aaPF14595.13Thioredoxin_921-90 aaPF00578.28AhpC-TSA21-85 aaPF13905.13Thioredoxin_828-72 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_008853 | PF00085.27 | Thioredoxin | 9 | 109 | 2.4e-31 | 108.5 |
| LXL04_008853 | PF13899.13 | Thioredoxin_7 | 15 | 87 | 8.9e-07 | 29.7 |
| LXL04_008853 | PF13098.14 | Thioredoxin_2 | 17 | 108 | 7.5e-10 | 39.9 |
| LXL04_008853 | PF14595.13 | Thioredoxin_9 | 21 | 90 | 4.5e-07 | 30.5 |
| LXL04_008853 | PF00578.28 | AhpC-TSA | 21 | 85 | 1e-05 | 26.1 |
| LXL04_008853 | PF13905.13 | Thioredoxin_8 | 28 | 72 | 2.2e-06 | 28.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.